PNG  IHDR* pHYs+ IDATx]n#; cdLb Ǚ[at¤_:uP}>!Usă cag޿ ֵNu`ݼTâabO7uL&y^wFٝA"l[|ŲHLN밪4*sG3|Dv}?+y߉{OuOAt4Jj.u]Gz*҉sP'VQKbA1u\`& Af;HWj hsO;ogTu uj7S3/QzUr&wS`M$X_L7r2;aE+ώ%vikDA:dR+%KzƉo>eOth$z%: :{WwaQ:wz%4foɹE[9<]#ERINƻv溂E%P1i01 |Jvҗ&{b?9g=^wζXn/lK::90KwrюO\!ջ3uzuGv^;騢wq<Iatv09:tt~hEG`v;3@MNZD.1]L:{ծI3`L(÷ba")Y.iljCɄae#I"1 `3*Bdz>j<fU40⨬%O$3cGt]j%Fߠ_twJ;ABU8vP3uEԑwQ V:h%))LfraqX-ۿX]v-\9I gl8tzX ]ecm)-cgʒ#Uw=Wlێn(0hPP/ӨtQ“&J35 $=]r1{tLuǮ*i0_;NƝ8;-vݏr8+U-kruȕYr0RnC]*ެ(M:]gE;{]tg(#ZJ9y>utRDRMdr9㪩̞zֹb<ģ&wzJM"iI( .ꮅX)Qw:9,i좜\Ԛi7&N0:asϓc];=ΗOӣ APqz93 y $)A*kVHZwBƺnWNaby>XMN*45~ղM6Nvm;A=jֲ.~1}(9`KJ/V F9[=`~[;sRuk]rєT!)iQO)Y$V ی ۤmzWz5IM Zb )ˆC`6 rRa}qNmUfDsWuˤV{ Pݝ'=Kֳbg,UҘVz2ﴻnjNgBb{? ߮tcsͻQuxVCIY۠:(V뺕 ٥2;t`@Fo{Z9`;]wMzU~%UA蛚dI vGq\r82iu +St`cR.6U/M9IENDB`ELF>$@(@8 @## `#`C`Cx. e$eDeD888$$### Std### Ptd \l\lQtdRtd`#`C`CGNUi"3ԭpeH6 $Q!x`|<ҤB^??  * /~ B R u k K   |r  MCo; W-4 A  L  1. M  R {  |lRq j   *P , EqQF"I 0 ^ *Y e   : wcf 4 n L  ' I k+ - B c@,QW    ef7)Ka s |U90x    c J2  : "u r   ^; S>L  4PE  ~ b5Il%D _;"#*  / " +                 __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize__stack_chk_faildm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroystrlenstrncmpstrcmp__lxstat64strdupdm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_unregister_handlerdm_event_register_handlerusleepdm_event_handler_get_dsocallocmallocstrncpystrcasecmpfopen64strstr__getdelimfclose__errno_locationstrerrorunamectime_r__ctype_b_locumaskgetenvfgets__xstat64sd_id128_get_machine_app_specificfcntl64stdinstdoutsetlinebufmalloptsetlocalegetpidsyscallsetvbufmemmovestrchr__ctype_toupper_locstrtollstrtodfputc__fprintf_chkstrspnfwritememcpymemsetio_submitio_destroylseek64io_geteventsio_setupsysconfposix_memalignreallocstrcpyalphasort64scandir64opendirreaddir64closedirsscanfudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirflockunlinkstrtolctimefflushrenamefsyncudev_device_new_from_devnumudev_device_get_is_initializedioctl__fxstat64udev_device_get_property_value__snprintf_chkreadlinkstrrchr__memcpy_chkdirname__xpg_basenameblkid_get_tag_valueblkid_new_probe_from_filenameblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_probeblkid_probe_lookup_valueblkid_free_probeblkid_probe_step_back__sprintf_chk__ctype_tolower_locgetcstderr__vfprintf_chkfeofversionsort64fdopenrand_raccessferrorfputs__vsnprintf_chklocaltimestrftime__strncpy_chkprlimit64snprintfclock_gettimelocaltime_ropenlogcloselogsd_journal_printv_with_location__vsyslog_chkabortdup2fscanfsd_journal_send_with_locationqsortstrtoul__assert_failstrtoullsysinfoforkwait4execvppipewaitpidgethostnamesigprocmasksigactionsigismembersigdelsetsigaddsetsigfillsetudev_unrefudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_newgetpagesizegetrlimit64mallinfomlockallmlockmunlockallmunlockgetprioritysetprioritysd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namestrncasecmpmktimesymlinkrmdirsetmntentgetmntentendmntent__printf_chkputcharoptargoptindgetopt_longgetuidgeteuidnl_langinfoperrorgetppiddirfdunsetenvnanosleeprewindsetsidlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_runlvm2_initlvm2_init_threadedsocketconnect__fdelt_chkselect__xmknodmemchrselabel_lookupselabel_opensemctlsemopsemgetstpcpysetfscreateconfreeconis_selinux_enabledlsetfileconselabel_closechownftruncate64gmtime_risspacememccpynearbyintpthread_mutex_lockpthread_mutex_unlockstrndupmemcmplibdevmapper-event.so.1.02libdevmapper.so.1.02libreadline.so.7libsystemd.so.0libblkid.so.1libaio.so.1libselinux.so.1libsepol.so.1libudev.so.1libm.so.6libc.so.6liblvm2cmd.so.2.03BaseLIBAIO_0.4LIBAIO_0.1GLIBC_2.2.5LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_1.0BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.3GLIBC_2.17GLIBC_2.3.4                0t0 q0    ui  9   z Pb b, b; bJ   #Y  PA e ep A z A      ii   ii  ti ui  `C&hC%pC&xC%CCCCXClCCCCHCPCXxCCC@C@ C0v(C20C:v8Ca@C*cHC:cPCGv`C\|hC`pCxCEdCCCUC_ChCC(C@CXCpCCCԱCCCCغC0CHC `CxC)C>CPCCiCC C8CPCDzhCײCC(CCCCCA CE(C0Cx8C@CHCŏ`C6hC,pC_xCiCsC}CCCCC C8CPChCCuC!C5CNChC}C(C@CXCpCCCC C8CPCCCCC(C@CXCpCCCACACe;C6 Cp(Ck;0C8Cs@CAHCr;PCVXCiI`Cv;hC^pC:CACcC|;C` C" C" C`$ C`$ C n CK C" C`K C" C" C" C` C" C CP C n (C 0CP 8C @CM HC" PC" XC" `C` hCK pCK xCp CL C" CK C" C" C L C| C@L C` C C`L C@ CБ C` C" C" CL CP| CL CЄ C` (CL 0C 8C@ @CВ HC" PC" XCL `C`M hCg pCM xC M C# C C" C@M C" C" CM C CM C` C C CG C` C" C" C" C" C C" CP (C 0C" 8C @C" HC" PC" XC" `CM hC` pC: xC CP C@K C" C" C" C" C" C" C" C" C" C" C" C" C" C" C" C" CA(C0Cr8Cr@C HCPCXC.`C5hCApCNxC\ChCtC|CCCCCCǜC՜CCCCCC'C7CECUCc Cp(C}0CC@ CC C,PC XC6C CGC C\pC xCqC C0C 8CC CC CPC XCDZC CpC xC C CԱCpX CC CPC` XCC_ CCP_ C pC^ xChC ^ C0CP] 8CC+ CC- CPC- XCC* CC@ C5pC* xCHC* Cx0CP* 8CC * CC3 CPC\ XCKC\ C CpU CHpCP\ xCpC C0C 8CCN CC CcPC XC0C CCpc CxpC@n xCC[ C0C? 8C0C= CpC`j CPC0i XCC C8Cp CppC: xCCp: C0C: 8C@C@ CCZ CPC` XCC0r CCc CpCn xC0C@a Cp0Co 8CCa CCpo C0PC b XCpCo CCb CpC0p xCPCc C0Ck 8CƲCl CC0 C PC Z XCHCPY CpCX CpCp` xCC, CԲ0DW 8DD DD D8PDW XDxD D D@3 DpD3 xDD2 D0D2 8D3D DDp DXPD XDD DD DpDpG xDMD G Da0DF 8DtDF DD0F DPDE XDDE DDU D(pD xDҳD0E D0 D 8 D DT D D1 DP D1 X D Dp1 D0 DPT  DPp DS x D DS D0 D O 8 D D D DD DP DD X D8 D@D D@DC DVpDR xDhD@l Do0DP 8DD DD DPD0 XDD DD` DpD xDD R D0D0 8D@D DδD DxPDp XDDQ DhD) DpD) xDD) D80D@ 8DhD@ DDk DƲPD XDD DD0 D pD0 xDxD1 D0D, 8DD@Q DDP DPDk XDoDP DD DpDO xDhD D0DP, 8D*D, DCD`) DPDP+ XDZD DpD+ DpD+ xDD` D0D 8D@D@ DpD@ DpPD` XDD D D  Dp D@ x Dh D@ D(0!D@ 8!DX!D@ !D!D@ !DP"D X"D"DP "Dȵ#D #D׵p#D@ x#D#Dk #DƲ0$D0m 8$D8$D $Dh$D0 $DP%D@ X%D%D %D&DK &D8p&D@K x&D&D0 &Dp0'D 8'D'DPM 'D'DJ 'DP(D9 X(D(DJ (D8)DJ )D`p)D x)D)D )D0*D 8*D*D` *DX*DG *DP+Dm X+D+D C +D,Dp ,D0p,D0 x,DX,DB ,D0-D9 8-D-D -D-D -DPP.D X.D.D .D/Dk /DƲp/DB x/D/DB /Dh00DA 80D0D0A 0D0D@ 0D@P1D@@ X1D1D4 1D2DP 2Dp2D/ x2D2D@/ 2D@03D. 83Dh3DL 3D3DPN 3DP4D09 X4D4D@. 4D5Dp 5Dp5D`q x5D05D8 5DX06DP8 86D6D7 6D26Dp7 6DP7D7 X7D7D6 7D8D 6 8D8p8D5 x8Dh8D4 8D09D0L 89D9D@ 9D9D@ 9DHh:Dfp:Dsx:D :DA:DA:D@ :D|:D :D:D:D :D:D:D ;D;D;D (;D 0;D8;D H;D˶P;D۶X;D h;D߶p;D۶x;D ;D;D&;D ;D ;D$;D ;DA;DA;D+;D+;Dk DJD>DE>DA(>DJD0>DE8>DAH>DJDP>DEX>DAh>DpJDp>DEx>DA>D`JD>D`E>DA>DPJD>D@E>DA>D@JD>D E>DA>D0JD>DE>DA?D JD?DE?DA(?DJD0?DE8?DAH?DJDP?DEX?DAh?DIDp?DEx?DA?DID?D`E?DA?DID?D@E?DA?DID?D E?DA?DID?DE?DA@DID@D E@DA(@DID0@D E8@DAH@DIDP@D EX@DAh@DpIDp@D Ex@DA@D`ID@D` E@DA@DPID@D E@DA@D@ID@D E@DA@D0ID@D E@DAAD IDAD` EADA(ADID0AD E8ADAHADIDPAD EXADAhADHDpAD ExADAADHDAD EADAADHDAD EADAADHDAD` EADAADHDAD0 EADABDHDBD EBDA(BDHD0BD E8BDAHBDHDPBD EXBDAhBDpHDpBD` ExBDABD`HDBD EBDABDPHDBD EBDABD@HDBD EBDABD0HDBD EBDACD HDCD ECDA(CDHD0CD E8CDAHCDHDPCD` EXCDAhCDGDpCD@ ExCDACDGDCD ECDACDGDCD ECDACDGDCDECDACDGDCDECDADDGDDDEDDA(DDGD0DDE8DDAHDDGDPDD`EXDDAhDDpGDpDD@ExDDADD`GDDD EDDADDPGDDDEDDADD@GDDDEDDADD0GDDDEDDAED GDEDEEDA(EDGD0ED`E8EDAHEDGDPED@EXEDAhEDFDpEDExEDAEDFDEDIEDAEDFDEDIEDAEDFDEDEEDAEDFDEDEEDAFDFDFDEFDA(FDFD0FDE8FDAHFDFDPFDpEXFDAFDAFDAFDAFDAFDAFD' FD' FDAGDΰGD6(GD8GD{HGDXGDhGDxGDGDGDGDGDGDGDGDGDHDHD(HD8HDHHDXHDhHDxHDHDHDHDHDHDHDHDHDIDID(ID8IDHIDXIDhIDxIDIDIDIDIDIDIDIDIDJDJD(JD8JDHJDXJDhJDxJDJDJDJDJDJDJDJDJDKDKD(KD8KDHKDXKDhKDxKDKDKDKDKDKDKDøKDKD͸KDLDԸLDLDظ LD0LD߸8LDHLDPLD`LDhLDxLDLDLDLDLDLDLDLDLD LDLDLDMDMD MD(MD8MD"@MDDPMD'XMDPhMD0pMDtMD7MDtMDMDtMD;MDMD jMDMDJMDMDBNDNDGND(ND0ND@NDJHNDXNDM`NDpND xNDNDPNDNDUNDND[NDND`NDNDcND4ODkOD4ODo OD@0ODx8OD@HOD|PODL`ODhODLxODODXODODXODODdODODpODODpODOD|PDPD| PD(PD8PD@PDPPDXPDhPDpPDPDPDPDǹPDPD˹PDPDԹPDPDعPDPDQDQDPQDUhQD_QDhQDQDQDQDQDRD(RD@RDԱXRDpRDRDRDغRDRDRD SDSD)0SD>HSDP`SDxSDiSDSDSDSDSDDzTDײ TD8TD(PTDhTDTDTDTDATD\TDZUDUD"0UD7HUDn`UDGUDEUD@EUD "UD!UDUDVDVDp(VD` 8VD HVDXVD@hVD xVD VD VDStVDVDUvVDhVD\vWD&WD0WDHWDgv`WDxWD WDEWDxWDlvWD WDvvXDg XDp8XDPXD|vhXDvXDvXDXDPYDXYDYDYDpZDxZDZDZDH[DP[D#X[Dh[DAp[DA[D0o[D`[D[DЪ[D[D[D@[D0\D0\D(\D@8\DBH\DBX\DFh\Dx\Dp\D\DP\D\DЙ\DЙ\D`\D`\D]D`]D`(]D8]DpH]DpX]D h]D`x]D`]D ]DP]DP]D`]D]D ]D ]D^Dp^D(^D8^DPH^D X^D h^Dx^D^Dp^D8oDT@oDGPoDXoDPf `oDoDGoD@OoDJoD8oD2oDpDpDpDpD pD pD(pD pD0pD0pD8pD0pD@pD@pDHpD@pDppDxpD0pDpDpDpDpDpDqDqD qD(qD8qDXqD`qDPhqDqD %qD?qDIqD7qD0-qD,rD&rD@ PrD %XrDPD`rDhrDFrD,rD&rD@ rDc8sDpsD=sDqsDcsDptDH=(tD`tD=xtDeDtD=tDcuD>uD7PuD>huDðuDvDB@vD>XvDuvD?vDVvDcvDBd0wD8?HwDmewDp?wDdwD@wDdwD@xD xD A8xDHxDdpxDXAxD-xDdxDAxD#d(yD-d`yDBxyDJdyD\|yDCyD;yDmrzDDzDfdPzD(FhzDvdzDPIzDCczDdzDHJ{Dd{D@{DKX{Dqh{Dd{DM{Dd{Dd{DS{D|D|DH|DdX|Dh|DP|Dd|DA|Dd8}DZDp}DxT}Dd}D0U}Dd~DU(~De`~DXx~De~D4e~DX~DIeDYD`e(DPDp[hDteDx]DeD^De@Dh_XDeD0`DeDcD d0D@dHDeDPfDeЁDgDe8DfpD0kD7fDpk؂DCfD@l(Dn`DnxDRfD(qȃDjfDqDyfPDthDfDfDuDxwDwD0{@DX{XDfD{D|D|DfD(D8}0DfHDfDx}DDІD(~D D`8DpDDDx؇DgDD(Dg`DxDЃDȈD0gD8DHgPDhDWgxDDDjgȉDgDDg@DXDghDD@DgDDg0DHDgDDgЋDpDh D88DhpDD7hDȍ،DLhD(Dfh`D8xD{hDhȍDhDDhPDhDhD@DhD`Dh@DXDhDDhDDi0D`HD%iXDDD6iАDD D8DFipDDYiDjiDpؑDviDD(Di8D(`DPxD_dD8ȒDiDpDiPD8hD2D`D;eDDi@DPXDiDDiD8Di0DhHDdXD DDðЕDDi8DiHDpD`D`DxDؖDrDxD(DeD`DxxDiDD`DȗD.D8Di(D8DpPDhDjDDjDDj@DHXD'jDDwDDnD0D`HD-jDDhКDDð D@8DAjDHD؛DRj(DcjxDvjDujD{jȜDj؜DjDjDHDjhDjDDjDjXDjhDkxDkDD)kDxD@k0DHDLkXD\kDrkПDPD8DkpD8DkDKDkDxؠDkD(Dk8DlHDl`DxD!lDwD8lDHȡDD@DQlPDxhDblDnlDl@DXDlD DlDDl0DXHDlXDADDlDlDmФDDmD-mDAm Dh8DQmHDhmXD~mpDDmDDإDmDmD@(Dm`DxxDmDȦDmئDnDnDD(n(D>n8DSnPD`hDdnxD|nDnDDnȧDDDnDm@DXDnhDnxDnDD oDmD@Do0DHD2oXDCohDSoDpD`oD\|ЩDDqo Dx8DmepDDoDoDتDoD(Do`DhxDoDȫDoDDoPDhDoDDoȬD6DDp@D0XD&pDD5pDDEp0DHDfpDDVpЮDDrp Dh8DphDpDDpD@دD[D8(Dw8D`DxDpDpDhȰDpذD0DDp(DpPDhDpxDhDDDqD8D7q@D XD D DSqD Dpq0D HDqDDqгD Dq D8DdpD`DqDشDqD(Dq8Dq`D xD rD(ȵDrDDrPDhD2rDDErDD(j@DhXDoD!D`rDDH#Dor0D`&HD8-DrDr8DrDrعD(DxDrDrD'ȺDrD(Dr(DAPDP*hD_D+D#nD+Dh@D8-XDlhDAD`-DrDrD-Dg0D-HDnD.DrнD8.Ds D.8DsHD)spD`/D8sDFsDAؾDSsDADA(Das8DA`D@BxDwsDsDBȿDsؿD8CDCDs(DDPDDhDsxDsDXEDsDEDFDsDpF@DFXDshDsDHGDsDGDGDsDPH0DHHDtXDtDID E E7( E0 E>8 E` EJh Ep EQx E EJ E EQ E EZ E Ea E EZ( E0 Ea8 E` Eih Eup E Ei Eu E E{ Ex E E{ Ex E EZ EEZE EfZ(E@EfZHE`EhEpEEEEEEEEEEEEEE E(E,0E@E'lHE`E'lhEEdEEdEEvEEvEEiE Ei(E@EHE`EhEEVEEVEE^EEE^EEEWE EW(E@EiHE`EihEExEExEEAEKE0vEE0~ Ep (Ez @Ez PEPy XE~ `E`~ hE0y pEy xEx E E E@ E E0 E E E E E EЂ PEP XE hE xE EЊ E EP E E E E@ EУ E@ 0E 8E @E HE PE XE `E E E E` E Eж Eh(E0E!8E@EHEPE~XE`E=TpEpExEpEEEEEE@ EEEE0EE`E0E E0E8E@EHEXE`ExEE0EEExE o`"ENBh"Ex"E!.EWB.Ex.Eb9EbB9E9E@o@EEjBHEEuBXEE!PEsPEBPES\EB\E\E& hE(hE(8hEsECTsEBsE`EThEBxEEBEXE E EBE@ @ECHEXE`'ECExE0oECE'CE E?C(EȊ8EЦEKCESCE@&`EiChEpCxE&ECEE E@E@E@EwhHEhXEЮ FC FC FFFCF "F("F8"F !-FC-Fȋ-F`9FCh9Fx9F0EFCEF EF3PFPFHPF]@\FCH\FxX\F'gFCgFgFdsF[sFsF  FC(F 8FFCȊFC؊FЋ`FdhFPxFp!FDF DF`F:DFCDF'@FsmHFXFRFVFF'F FFR F`D(F8FFlDF8F`FyDhF`xF;FDFFH GD G G'@GHGDXGH!GD!G؎!GT-GD-G-GW 9GD(9G089G]DGDDGXDG@a`PGDhPGDxPGb\GD\G\G zgGEgGEgG~@sG"EHsGXsG~G,E~G~GpGhG5EG GLE(GUE8GGkEȡG(ءG`!`GoEhGvExGGEGPG@@GxXGF`GxhGxGxGxGyGyGxGyG<G#yG(yGMyGCGYyG,yGD G8y(G@y0GLy@G@EHGXyPG`yXGjyhGDpGuyxGYyG|yGFGxGyGFGGyGFGGyGFG[ Gy0GF8G@HGy`G@pGyGFGyGyGyGp=GyGzGzGCG zG4zG=zG@GKzG`GUz G@(Gbz0Gkz8GzHG APGzXGz`GzpGAxGzGzGzG0BGzGzG6{GPBG{G {GzGBGzGzGzGBG{ G{(G5{8G0C@G{HG {PG0{`G0IhGA{pG {xG{GEG{G{GL{G0FGY{Gb{Gw{G@FG{G{G{GFG{G{G{(G0G0G{8G{@G{PGAXG{`GhG|xGFG|GG|G HG"|GG*|GGG4|GG:|GGGG|GP|Ga|GH Go|(Gy|0G|@GPJHG|PG|XG|hGJpG|xG|G|GJG|G|G|G`KG }GPG}GKG!}G/}G:}GKGI}GT} Ga}0G@L8Gr}@G|}HG}XGL`G}hG}pG}GPMG}GpG}GNG}GЁG}GOG}GG~ GE0G\|8GEHGEPGE`GEhGExGFGFG)FG6FGJFGZFGpFGFGFGFGFGFGFGF G G(G G8G5G@GFGPG[GXGlGhGGpGGGGGGGGGGGؐGGGG HG HG4HG(GDHGbH(GH0GH@GHHGHXGH`GHpGIxGIG-IG>IGWIGPGxGGGGlIGGIGIGI G80GI8G`HGPG`GؒhGxG(GIG JGHGxGGȓG$JG>JGGGTJGmJG@ GJ(GJ8GJ@G`PGXGhGpGGHGxGJGGȕGGG@GpGGȖGJGKGK(G3K0G@G(HGIKXG`K`GsKpGKxGKGKGKGKGXGGKGLGLG.LG?LGZLGG GqL0GL8G8HG`PG`GhGLxGLGLGLGLGLGMG%MG7MGNMGaMGtMGMGMG G(GM8GM@GMPGMXGMhGNpGNG3NGCNGWNGgNG}NGNGNGNGNGNGNGOGOG#O(G8O0GIO@G^OHGoOXGO`GOpGOxGOGOGOGOG8G`GPGPGPG0PG?PG[PGsPGP GP0GP8GPHGPPGP`GPhGPxGQG!QG6QGGQGZQGiQGQGQGQGQGQGQGQGQ GR(GR8G!R@G-RPG>RXGKRhG^RpGmRGRGRGRGRGRGRGRGRGSG'SG@SGUSGlSGS(GS0GS@GSHGSXGT`GTpG*TxG=TGSTGeTG{TGTGTGTGTGTGTGTGUG%UG;U GMU0G^U8GkUHGUPGU`GUhGUxGUGUGUGVG VG-VG?VGMVGbVGsVGVGVGVGV GV(GV8GV@G WPG&WXG;WhGOWpG_WGuWGWGWGWGWGWGWGWGXGXG(XG9XGNXG_X(GoX0G{X@GXHGXXGX`GXpGXxGXGGXGAGXGGXG7LGYGsw GY0Gw@GYPGm`GYpGG*YGaG8YG oG@YG2oGLYG\YGhYGK GsY0G@G|YPGe`GYpGKGYGeGYG"eGYGLeGYGlGYG6 GY0G)@GYPGJ`GYpGeGYGAGYGAGYG ZGZG&ZG4ZGCZ GQZ0G`Z@GnZPGZ`GZpGZGZGZGZGZG[G&[G7[GM[Gb[Gy[ G[0G[@G[PG[`G[pG[G[G\G\G.\GF\G\\Gq\G\G\G\ G\0G\@G\PG]`G]pG&]G:]GH]GU]Gi]G|]G]G]G]G]G] G]0G ^@G^PG/^`GA^pG\^Gv^G^G^G^G^G^G^G_G_GA G(_8GξXG3_pG=_GGE_GX_GȚGi_Gt_GG}_G_0Gh8G_PG_hGpG_G_GG_G_GG_G_G8G_0G_HGpPG_hG`GG `G`GpG'`G=`G@GQ`G\`(G(0Ge`HG|``GhG`G`GȩG`G`G`G`G`GG`(G`@G aHG%a`G2axG=aGZaGjaG0GxaGaGaGaGa G`(Ga@GaXG`GaxGaG8GfGbGG bGbG*bGCb GRb8G@G_bXGqbpG8xGbGbGhGbGbGGbGbG( Gb8GbPGXGcpGcG(GeG'cGȺG1cGAcGGOcG\c0G8GgcPGxchGhpGcGcGȾGcGcGGcGmdGXGc0GcHG@PGchGcGGdGdG(G*dG:dGhGHdGad(G00GxdHGd`GhGdGdGdGdGdGG eGeGG-e(G9e@GHGCe`GSexGGaeGmeGGweGeGGeGe G(Ge@GeXG`GexGeGxGeGeG GeGfGG f Gf8G@G#fXG0fpG;fxGqGTfGGffGpfGGxfGfG@ Gf8GfPGXGfpGfGGfGfGGfGgGGgG,g0G8GiPG>ghG@pGMgGWgGGqG_gGGqgGgGGg0GgHG0PGghGgG`GgGgGGgGgGGgGh(G0GhHGh`GhG'hG5hGGAhGOhG[hGmhGhHPHh(Hh@HHHh`HhxH@HhHhHHhHhH0HhHi H0(Hi@H)iXH`HynxHAiHXHlHLiHHSiHeiHHui Hi@HiXHipHxHiHiHHiHiHH gHjH Hj8H&jPHXH9jpHKjHH[jHvjHHjHjH HjHj0H 8HjPHjhHpHjHjHXHqH kHHkHkHH'k0H6kHHPHCkhHOkH(HYkHjkHHohHykHHkHk(H@0HkHHk`HhHkHkHkHkHkH`HlHlHPHl(H%l@HHH.l`H?lxHHNlH]lHHjlH{lHHlHl H(Hl@HlXH`HlxHlHXHlHmHHmH)- H H!m H2m8 HP@ H6qX HAmp H x HNm HZm Hp  Hdm Hqm H  H|m Hm Hm Hm8 HmP H@X Hmp Hm Hd Hu Hm HH Hm Hn HX Hn Hn0 H8 H,nP H8nh Hp HBn HMn H HVn Hfn H Htn Hn H Hn0 HnH HxP Hnh Hn H Hn Hn H Hn Hn HH Hn H o( H0 HoH Ho` Hh H$o H0o H` H:o HJo H HLt HXoHboHo(Ho@HHHo`HoxH HoHoHX!HoHoH!HoHp H"(H,p@HBpXH8"`HVpxHepH`"HrpHpH"HqHpH`#HZq Hp8H$@HpXHpxHpHpHpHpHpHq Hq8H$qXH2qpHEqHVqHjqH|qHqHqHq8HqPHqpHqHrH(rH2rHoH:rHKr0HXrHH&PHcrhHkrH0HqrHrH1HrHrH2HrHr(H20HrHHr`H3hHrHsHdHsHsH4H)sH7sH7HCs(HMs@H7HHUs`HasxH 8HksHzsH8HsHsH9HsHs H@:(Hs@Hs`HvhxHsHp:HsHmdH;HcHsH'f Hs8Hs@H.nXH`pH8<xH)hHtH<HtHξHtH'tH= H0t8H=tPH=XHHtpHXtHftH)-H >HrtH6-H AHtHt0HA8HtPHthHApHtHtHAHxHtHIHtHtH uHs`0HuHHKPH#uhH2uHMH?uHIuHMHQuHguH(NH{uHu(HO0HuHHu`HOhH}fHuHPHuHuHpWHrHuHXHu(Hu@HYHHv`HvxHYH"vH.vH8vHDvHYHNvHWv H](H^v@HuvXH ^`HvxHvH^HvHvH8_HvHvHv Hv8H `@HvXHwpH`xH wHwHHaH$wH.wH6wHF-Ha HEw8H\wPH(bXHfpHqwHeH|wHwHlHwHw Hw Hw0 Hl8 HwP Hwh Hnp Hf Hw Ho Hw Hw Hp Hw Hw!Hr!Hw0!HwH!HsP!H xh!Hx!H#x!H]d!HXu!Hv!H/x!H=x"HMx("Hu0"H[xH"Hnx`"H`xh"Hx"Hx"H{"Hx"Hx"H{"Hx"Hgd#H |#Hx(#Hx@#H|H#Hx`#Hξ#H#H#H#H#H#HP#H#H$H$H($H8$HPH$HP$HX$H`$HA$H$H%H$H%H%H%H%H %H %H(%H %H0%H0%H8%H0%H@%H@%HH%H@%Hh%HA%Ha %H%H%H`%H(H%H (H8&H8&H@&H8&Hp&Hp&Hx&Hp&HH(H^(HA)H)H )H)H0)H0)H8)H0)H@)H@)HH)H@)HP)HP)HX)HP)H`)H`)Hh)H`)H)HAJHJHJHJHJH5JH5 JH ZD@JH,PJH/XJHrhJH/pJHEJHHJHaJHHJH;JHfJHAJHwJHĻJHJHBJHKHBKHKH(KH0KH @KH`KHpKH xKHKHHKHKHxKHKHKHKHKHKH8KHLHhLHaLH LH0LH8LHHLHPLH`LH0hLHxLH`LHLH LHALH LHLH3LHLH$LHLH(LH2LHMH6MH@MHMHD MHN(MHK0MHR8MH@MH@HMH\PMHfXMHg`MHihMHspMHxMHxMHMH}MHMHMHqMHMHMH@MHMHMHJMHMHMHMH\MHfNHqNH NHNH3 NH(NH$0NH8NH(@NH2HNHPNH6XNH@`NHhNHDpNHNxNHKNHRNHNH@NH\NHNHgNHNHNHNHNHNHmNHNHNHNHHoD!hoDIpoDQxoDRoDYoD\oD^oDoDoDoDgDgDgDgDgDhDhDhDhD hD (hD 0hD 8hD @hDHhDPhDXhD`hDhhDphDxhDhDhDhDhDhDhDhDhDhDhDhD hD"hD#hD$hD%hD&iD'iD(iD)iD* iD+(iD,0iD-8iD.@iD/HiD0PiD1XiD2`iD3hiD4piD5xiD6iD7iD8iD9iD:iD;iD<iD=iD>iD?iD@iDAiDBiDCiDDiDEiDFjDGjDHjDJjDK jDL(jDM0jDN8jDO@jDPHjDSPjDTXjDU`jDVhjDWpjDXxjDYjDZjD[jD]jD_jD`jDajDbjDcjDdjDejDfjDgjDhjDijDjjDkkDlkDmkDnkDo kDp(kDq0kDr8kDs@kDtHkDuPkDvXkDw`kDxhkDypkDzxkD{kD|kD}kD~kDkDkDkDkDkDkDkDkDkDkDkDkDlDlDlDlD lD(lD0lD8lD@lDHlDPlDXlD`lDhlDplDxlDlDlDlDlDlDlDlDlDlDlDlDlDlDlDlDlDmDmDmDmD mD(mD0mD8mD@mDHmDPmDXmD`mDhmDpmDxmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDnDnDnDnD nD(nD0nD8nD@nDHnDPnDXnD`nDhnDpnDxnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDoDoDoDoD oD(oD0oDHHgBHtH5b`B%c`Bhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1%QBD%QBD%QBD%QBD%}QBD%uQBD%mQBD%eQBD%]QBD%UQBD%MQBD%EQBD%=QBD%5QBD%-QBD%%QBD%QBD%QBD% QBD%QBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%}PBD%uPBD%mPBD%ePBD%]PBD%UPBD%MPBD%EPBD%=PBD%5PBD%-PBD%%PBD%PBD%PBD% PBD%PBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%}OBD%uOBD%mOBD%eOBD%]OBD%UOBD%MOBD%EOBD%=OBD%5OBD%-OBD%%OBD%OBD%OBD% OBD%OBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%}NBD%uNBD%mNBD%eNBD%]NBD%UNBD%MNBD%ENBD%=NBD%5NBD%-NBD%%NBD%NBD%NBD% NBD%NBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%}MBD%uMBD%mMBD%eMBD%]MBD%UMBD%MMBD%EMBD%=MBD%5MBD%-MBD%%MBD%MBD%MBD% MBD%MBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%}LBD%uLBD%mLBD%eLBD%]LBD%ULBD%MLBD%ELBD%=LBD%5LBD%-LBD%%LBD%LBD%LBD% LBD%LBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%}KBD%uKBD%mKBD%eKBD%]KBD%UKBD%MKBD%EKBD%=KBD%5KBD%-KBD%%KBD%KBD%KBD% KBD%KBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%}JBD%uJBD%mJBD%eJBD%]JBD%UJBD%MJBD%EJBDfD.9HP%9HtR,t*AL$F1L@^H5WQA zHH=9HHtH8H);F8HXSH=Ht 8HH=_FjHHtH5VHu F[H5HtH5 OHuF[ÐH=(FH(FH9tH.IBHt H=(FH5(FH)HHH?HHtHHBHtfD=e(Fu+UH=HBHt H=ΧAd=(F]wAWMIAVIAUAATMUSHHXdH%(HD$H1$Eu AG\ 1LT$MtM\$HHk HD1EHLLATUARD$D$$ H Ņl$Ht-HD$HD$ CHD$(HC D$0CHD$HCHL$HdH3 %( HX[]A\A]A^A_L$Z L$fY L$ DLL$茕L$H)Li1ɺ1H5erf.LL$LT$L$HL\$HE1E1j11LjLARLT$ H L$L\$tD$E1AcL1ɺ1H5 ff.fAWAAVEAUIATIUHSHHHI$HteHHtHHLHuNDHsDHhHH[]A\A]A^A_fD1LHI$|Lɟ1ɺ1H5şH1L1ɺ1H5DLq1ɺ1H5mDLI1ɺ1H5E_"f.AWAVAUATUSHXdH%(H$H1HHLL9E1Ll$@L|$f.HEELHPPL@H1HHD&HHHL5H߅u?H1DH$HdH34%(9HX[]A\A]A^A_HLH߅tFaT$D$ O&HHHLX5H߅u91l@1L1ɺt H51@CH߉D$ D$ HmAL9D1L?1ɺ H5=W11L1ɺ H5/1cAWAVIAUAATUHSHHHFPH&DH=7"FI菤HgH1ɺoPH51L "FLHY^HL-OhL{A`<@HEPLLHuC' IHHLH L H$H8^fL1cH5u Lu1ɺh1H5u`f.H1VATLAUI1H5uXZJ@MkLH5Qu11gfL)u1ɺ1H5%u?f.M}LTUDAUIHE1ATE111USHHHGPH83tOHCPHH8 IHtgLHHa LG H[]A\A]f.LW1H5PtjH[]A\A]D1Lt1ɺH5t15H[]A\A]ATIUSHHdH%(HD$1HGXH-H2HCPHH8 Ls1ɺHHLHL$HH ¸HL$dH3 %(H[]A\HLHHHXHCXH2THL~I1H5r 1rfH D$\Lr1ɺ1H5r14@HHL?~If.AUIպATAUHSHdH%(HD$1HGPHH8! Lr1ɺHtdDLD$LHHH t$HL$dH3 %(uGH[]A\A]H T$tLq1ɺH5q11ff.AUIպATAUHSHdH%(HD$1HGPHH8A L:q1ɺHtdDLD$LHHH t$HL$dH3 %(uGH[]A\A]H T$tLp1ɺH5p11ff.ATIUHSHdH%(HD$1HGPHH8f HtqHHL$LHH[ Ņt%H HT$dH3%(u`H[]A\fD$tLp1ɺ1H5 p'DLo1ɺ1H5o16fDAUATIUSHHHWXdH%(HD$1HGPH HHH8x Lqo1ɺ/HtcLD$LHHI t$HL$dH3 %(uGH[]A\A]L T$tL o1ɺ4H5o11VfDUH1SHdH%(HD$1Ht5H$P H8UHL$dH3 %(u1H[]DLwn1ɺBH5un1fDAUE1E11ATIHUSHHHGPH8uH[]A\A]f.HSXHCPH HH8H IHt&LHHh L H[]A\A]ÐLm1ɺ[1H5m1qAUIATUSHZŅIM1L9u>fHL9t-H{/ tHsI}HL9uHA1AL/yH5l XZH[]A\A]f.AVAUIATUSH0dH%(HD$(1ŅIM1L9tRI @HL9tAH{_ tHsI}E11ALthL$1HL9uHA1AL2mH5l%XZHT$(dH3%(u1H0[]A\A]A^Lk1ɺwH5k@ff.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HL$dH3 %(u4H1LwH5*kD1{ff.HGPHH8ff.fATUHSHGXHH"H!r|1H詋 u-HEHsHHxPKIHtH脋 ,@HEHsHHxPKIHtHW GAD[]A\ÐHHHxPJIHt@\jHZHUHuLKAą?Li1ɺ1H5iDHHHxPIJIH@\HHUHuLAąLqi1ɺ1H5mi fHUHuLAąL.i1ɺ1H5*iDHH HCXH| tLp yHUHuLAą^Lh1ɺ1H5h>HHHxPIIH@ZHSHUHuLAąL)h1ɺ1H5%h?f.ATUSHGX@uj ueH%IHt_HCPE1E11ɺHH83t?HuH H苈 Ņt5[]A\fH߽cu[]A\HLh IH59g1QI$裗 2fH]HHCXIRUSHH $H1dH%(H$1HHHHH@ H_H$dH3 %(u H[]ͼff.fAUATUSHAHHHHHIMHHA1HHeHH1Ht#uAH9H[]A\A]@H@t AE%A$Le1ɺ1H5e1Lae1ɺ1H5]e1uH[]A\A]L)e1ɺ1H5%e?H[]A\A]fLd1ɺAVAUATUSHIHHHEELd1ɺHHAHDHELAAL|d1ɺHHHEuY̼HAEt`L eH11SLeH50dOXZ[]A\A]A^胱HAhL `eEuLc1ɺ1H5c[1]A\A]A^Lc1ɺAWfAVAUIATIUSHuHdH%(H$1)$D$HD$L)$)$DŽ$Ht BHӉ$' IEXH.rH/rxCAE\ IEPE1HL$PLAH8PDt$XALqHLYoIAVmDLhEH.H HxG] tHA;QL HYL 5RRLcP1H5+bEXZH$dH3 %( H[]A\A]A^A_tLd 0 Ld tDsED$(LDIIHD$Mt+IHtZDHtH@@ ML;t$qH:QHD$HDLl$H$H:HEHD$8HT$0DEVL1Et#H@IHЃ8KA9^LwIHtH$LPIHtH$L^IHt1҉LnIFHP€}AF1 rH@ H@pHa0IvpI|$D$HD$L"H]A11HLtHH1HEL_11_H5_H$IF@I~]H1ɺePL O1LlH5_蠾AZA[1WD# 9;fDD{Eu0L7 t$IEP1H LHHx SI1LHpHÅL^1ɺ1H5^LxH9kL jDHp1҉LL^1ɺ<H5z^虽D$(q@Ll$LL|$HLLLЅD$HOT$LKH|$L_1ɺwIH5 ^1%! M6L;t$Ll$DL$(E! ÅTLxHU_L SMLDH1ɺPLqkH5]1讼_AXhfDLi]1ɺIH5b]聼D$(@L9]1ɺPH52]QD$(v@L ]1ɺVH5]!D$(f@D$LIFH@ Hxx H|$H>^IFHDT$8HX0HT$ ZHT$ 1Lj^IH5\1R{S蟻IFAXAYH@ HXxJ bHY1LӅըuHD$@^Ld$ 1Ld$l$,Hl$0YL$H(LH1ɺUILiH5[1i'XZ®IFLLLD$HH@ Ppu1ɺl$,L{[H5[Ld$ 蚺D$(M6L;t$Dm\$(Ld$ l$,CD\$LE1D$(%DIvH8HD$HHtI|$HD$HH[t D$H%H߉D$LL$Ht$LHD$H8g H[H|$HD\$81H5aZSILV\1t$ e^_ 6IFHT$@tIVpHt$E11A L Ll$LL|$HD$LH|$L[1ɺILY1ɺTH5Y͸HHHH$H߅$7LRY1ɺH5KYjD$( L&Y1ɺW1H5"Y<S1D$(Low 8IML9!D$(L8Hp1҉LM9LM?LOLke IH5X1蘷UI1҉LLAX1ɺ1H5:XYMD$(L;t$;f.I~pULW1ɺ1H5WLW1ɺ%H5WD$(I~ZH1ɺkPL LdLl$L Off.@AWAVAAUIATIUSHHHdH%(HD$81 HAXtfH 3HQPH@uKHHHm HCPHA$tHCXHE+H߉Ņ#K H߅r EAEAu A}HH OTEEL=OTL5SH-=@HDʅHLDLDEHL$HD<HL$L0T IH5mQ1QAWAVUzH 1HHL$LŅL$tT$u D$(1H9H5TLe; LHZŅ(H5TL< LHLLP1ɺ7 1H5PůaHAPH@_HCX1 Lj_IH5LP11bHt$8dH34%(HH[]A\A]A^A_DH2C[uHhH@[L^11 H5OHhL_ IH5O1豮J@H0 L]IHx%HCPH@HxAEI]()f.LQ1ɺ IH5N1DLN1ɺ3 1H5NǭH5HRL9 QH8 L\IHp8H(HHCXAl$$1LHc 9H߽LP+ IH5M1fDHL赳AE@LM1ɺ# 1H5M跬PfLy[1ɺ 1A$?H5lM膬輣ff.AWfAVAUATMUHSLHdH%(H$1$$HDŽ$$$D$<ĺu8AH$dH34%(D H[]A\A]A^A_fD t_D$HH-iOHEHD*H1ɺUIL^OH5TL1qAZA[h$E1E1HHL$pH蓿ADžDD$pD$tEt"t.H5OHAQ6 @fD1HN4HCXH0H@AD$Y@HjHD$HLLHD$1H_ u E[H讹5H\ I1H!PHLH5AL( HEPHH8 HHKHH ADžH譶 E\SH5AL( E1E11LHL.t $_HWLKN IH5=1蠜rH0j IE1E11LHL述;<$@HLL9AI@4$EHL9!HsE1E11LLZuL<1ɺ H5<A@L<1ɺ{ 1H5<E1贛3L?1ɺq IH5g<1AK@E?L)<1ɺ 1H5%<?f.L;1ɺ1H5;H觴 fE[@AE[@d1E1ALHLe $t T$+#HLE1HXI9f.H{prHCxAHXI9uIEHʴHLRKAWIa 1H5: AX1AYL: H5:1L:1ɺ1H5:E1輙HHE1%LJ IH5V:1nffIw1ɺ AL :H5:1L91ɺ H59 CUHSHH諧t7HC@Ht.Hx8HktH{@HH[]u DH1[]H3% uH& fDL1J1 H5B9\H HH f.SHH dH%(HD$1HD$JHD$H9t HuPHt$HtHD$HL$dH3 %(u-H [HT$H5Hf.1׎HGX@ UHSHHH9t+HCHxHuHCHxuHH9u1H[]fHCHx裱L; IH571HCH@H[]D1DUHHSHHX H߅uYHtYH+HH HLhHUIQ 1H5J7dH1[]#HuHfVHKXHH[I11IH+]I,Aff.SHH VH1[HfUHHSHdH%(HD$1HGPH$H8t@HH5HÅt`HL$dH3 %(H[]fDHLG4 IH5/61GDHȯH<$L HHt谯IH: 1ULmGH55XZR(G\ u tfDUHHSHHHGPH8tH[]DH]H[]DUHH59SHH H|THIHI[111]fUHH58SHHd HFH5BD1@Ht)E1ۅtHH|HHtԀKIL%F11H5A1聎 @Et<$tHUH5sAMAULOEg114Y^hH8ooOL|AdH%(HD$(1L eAD$ )$)L$M9tjIQ0MA0L9tUHfHBHHwH3H3pH u1HOHwH3HH3pH uH@HHT$(dH3%(uH8HL9uM M9u1评ff.@H8ooOLAdH%(HD$(1L AD$ )$)L$M9trIQ0MA0L9t]HfHBHHwH3H3pH u9HOHwH3HH3pH u$HHT$(dH3%(u!H8HL9uM M9u1SHHtHt H{Hdt[fDH{tHsHH=EH9t&H=EHsTfHH[DHsHH=E@ff.HH=qAWEH=KAH=/AH=ATH%EHt8~>HEHt"}(HHEH1HfE@-Etf-ff.ATL%AU1SHAL9tH{HHL9u[]A\fREDHH9tH;xu @H9xtHH9u1f.HH=ALu H@H=A,HAUATUH-ASHHAH9toII"HSHLHPHH9tEI|$VHuѹLAH5=H1[]A\A]fH[]A\A]UH$AHSHHAH9uKfDHH9t=H;kuHR@LAIH5<1kHHAHAH9uVfDHH9tHH;kuH@LAIH52<1 HH[]]DH[]ÐF<t$tH@fDƇH@ƇH@ATLGUSHOHL9t;qM1AU@_H58cT}_AXIHL{IGHHpM_LL\$I I0H=nELL\$HHD$@1oML=H57ĄLT$L\$IJTIBTHQH3EH3UH HAHQH3EH3UH tHML=1Q}ArHH5y7E1UPIHH cvL[vwfD1L$2H567H{HH%LzHCHHH{H{ H{0}Ls@HLH=EAŅtPHH1AŅH{HuHuL@$11OH56VH{HguH_uL$11IH5H6ZfHt$H<$L\$ HL$(LT$LT$H<$D$ILT$DD$LT$L\$ E…H@HL$(LL$p@L\$LL $H- L $LT$L\$OL$L;11AƇH5o5AƂAQMAUE1YL;^1ɺH5:51L$LH=pAL$L$fDHH=NAAfDM9L\:H541E1螁fMbL$:f.A AƇAƂHfHhsML :>{H=ELLL$L$AM1L-;H54܀IHrLrfDLrMLy9g~H=ELL$H=ֶELLSL$AJM1LN:H5W3-i1ɺL$L H5*3LL$L\$LL$L\$L$q#wSHH0HtH@HHtHt HH[顶[ff.ESHt.HHtYuHu?H{HpT[QH=EHuL 1ɺH5U201[@L1ɺH5.2 HNEHt#HHHt$HH=)E|Hu1HATHfUSH0H=EdH%(HT$(1)$)D$D$ HHooPIHL) $)T$HHt~HtH@hH9tHu#HL$(dH3 %(Hu\H0[]A\HH{hH贔ATLV8UI@1H50}XZ1tSH1HǨHHtf[DH8L,8IH5}01Q}1[ff.fSHHǨ1HuHt%HPHH9t;ZH--HXHHI1t$I1H5F"oXLZrM1HILHPLc`M$$M9ufH蘅H|$H苅U1H5!ATIL+1nD$0Y^IHl$H$H|$\ HL$IHihHcHE8H%H9 L91(fDHg HHL9X IHcHsHF8H%H9t1ҹL'uH,$11H%H$H LL`L $@Ls,Lh'H5 1mL$M9fL|$0Lt$x-H~LFH3xL3@I LxPHxXMiE1HD$fH|$0E1E111LVH|$0E1E111HމD$@VH|$HLD$D1mH|$HHމD$\ m|$ D$`s?|$(D$df?t$8|$ D$ht$<|$(D$XHH=HDH߉D$l*LHD$pHIT$L+Ut$LH-bLyVL$@QH$Qt$`VL$PH51Q@P1lH@MHH5_bIEHt$(褂HL$LHD$ HHE苂MH5.bIT$LDHL5+Ht$0LVHL$0H5Q@UP1AWykH$HHt$PH0 LH$I HIT$@Ht$(L*LVH5:AWUH-P1t$xkH0D\$HHWEHDHT$ 蠁L?LINjD$IE脁Ht$ IT$L*@VLH5AWUH-P1jH D$`HHILEL\$ HLINjD$\HDHt$ IT$LA*@VLH58AWUH-.P1jH D$hHHwILELT$ 蜀H]LINjD$dHD耀Ht$ IT$LX@VLH5AWUH-P1iH D$lHHILEL\$ T$XLIDžHHDHt$ IT$Lm)@VLH54AWUH-P1hH L$DHHILELT$ t$@HsLIDžHD|Ht$ IT$Lo@VLH5AWUP1hH H|$ZLZ|$@DT$H E+HIM$$L;d$xI\$L9tH5qAL)H5bAHAƉD$D D$IE8H$LHHHH L$ HC8T$8HHHH L$( ‰T$<u HDŽ$H$Hzu HDŽ$ID$HHD$PH$H$H$H$ID$HHHtDL}HHH^H߅$}HH&^$ID$Ƅ$`H$@o)$@oHAH)$PH9tEHJ0LJ0I9t)fDHAH>LFH38L3@I H L9uHHAH9uE1HD$E1DL$EtNDD$EuDLHDH51ALH5"AH߉D$D$D$$ȃHP|$@ t$D LHF)@+|H|$H|H1ɿHT$ I1L!H5[RUAT-eD$@H pDH|$0LDH|$0DHHD$ϻIHD$HtLH'\$MLL\$H$L|$0Lt$xH} L;hhL3{HH$Hxh{S@PLL$1L$H5Y4dH$_AXL9t&L;nufL9nH6L9uLzHL^%PLL$ H5f.HHozH1ɺt$I1L!H5cAYAZH|$HD$HXhH9H$IH(L9*HXL,$H]HHyH1ɺAUI1L!H51cXLZ]I1HILHPc`HEL9uLHvH$H{hoyH@L!PLL$+1H5bL$LkhAXAYM9LyH@L#PLL$H5V1*bY^H$LL9I1HcfDL1ɺGH51aHxxHHmxSL1PLL$1H5aA[[DL9aH'xH1t$I1LtH5e;aXZ@H$YHH$H$HHQhHPfD;"L $L"11E1E1H5`HD$fH|$Hl$H]hH3wH1ɿt$I1H5xLG`YH^DH|$HD$HhhHvH1ɺt$I1L!H5_AYAZH|$1HLIHPH$e`I\fL $L11H5_H$fDH=AH-j H$H=AH$L$H;$t\H{usIIH501@_HC11H@HtHHL9uH$H-L$H;$tJf.H{guI@yIH51^HsLHL9uH$H=AL%AH$@L$ HAL5WL9uaD1ɺaLL ^H{tHc1UIL1L]HXZL9HC@HLoo)$ )$0= ul@Ht$1LH\$LHIf9I1MLDLl$+HHH$HH{sHILP@!H5"1\AZA[fLsH1ɺt$I1LH5\T_AXHtLhH$HaH$L9t&L;oufL9ovH?L9uHsH1ɿt$I1H5[L*\Y^H|$1HLIHPc`DL$DtT$@HHD$PH$H9WH$H9FLH\HXrH1ɺt$I1LH5l[]S_AXHtHhH$HH$L9t&H;ouIfH9o6H?L9uHqH1ɺt$I1H5 LZ_AXH|$1HLIHPc`HhqH1ɺt$I1LH5 |ZmRY^HtHhH$H"H$IL9HZH9[H@H9hNHHL9uH*L,$I$L9L54Mf.IhLpIM1AWpH5 P1YA[A_HL9sHC11HIHtH@h@HLoo)$ )$0 eL1ɺmH5K &YAH|$LoH@H5 PLL$1LLXH$AYAZL9u9LxoHL PLL$H6L9tL9nuH$HHL$PH$H9uH$H1 H9$$ȃutH D|$XEtgDt$lEu]LH f.KfD;H+H$IeLH al$ltD\$XH ED|$dt|$huLH 'N|$ht|$dH  |$\t|$`uLH |$`t|$\tLH| f.HH1HǨGHtHHfDHff.AWAVIAUIATIUSH8L$ H\$HdH%(HD$(1XLL=HdLxHhI9u"}DIOhHHHH-M?I9t]FHuֹLVH5I $V1HT$(dH3%(?H8[]A\A]A^A_Hl$H9tfDH}HmH9uLL{Ht$ML11cH5UD$ IHLt](Lt$I.LI9t$LIGHHmH9uLLHtJf.;fL1ɺRH5&U11MLF1ɺpH5T1 Lf.1DfIHtHHLnm1f.AWIAVLrAUATUHSHH(L"MLt9H{PH{LkPMLK`LE@fDLK`LE@LkPMt&I}HLLD$L $*KL $LD$LLHL(AŅuyM-1LKH5SH(D[]A\A]A^A_H~P1>t"LkPM]H{,@LkPLLH&AŅDmPEu H}XDu`AAuDA9tqsƃAƇH{hT$H4$oiH@LHt$I1VT$H5R~AUATAVsRH0ADvƃDL{PMtAHuXUTBA9Q#MAI9u9tH{hL$T$H4$hAUL$MLwE1QHt$1VT$ H5RAVP1QAƇH0Md fDE1MPMLK`LE@D]TE\fDHCPHxH+& D8@M61LH5#Pj@MAH{hIET$H4$zgH@LHt$IVT$RvAUATAV1H5~PHCPH0L]0HPPHM@LuHLm8D1H $DXPMHHtHLHT$qGHT$trH0BHSPLHT$FHT$HHHRHH{hHT$fAUHT$LI@1RH5O_AXMt}HCPLMtLLFt^LALkPLFIHMmHH{hfAV@H5cAUIL1&OY^H<$Ht|HCPLMt LSFt`LAH<$LkPEIHjMeHH{he4$LATI@1H5NXZI0HhLOH]L#H9HHLL2M$$H9uAfD1LH5I$NHC`LpHLH{PqMfAH{hIAƇET$H4$dH@LHt$IVT$RAUATAV@AH H^H{hHDHHHL\$HT$HL$dHT$LEIH5c1RHL$Q@+MAYHCPAZL\$fHCPHxHfDMMLH5LM1L]H5LMLH5rLL $L0H5tJLAVfAUATLUSHoOhHdH%(H$1HD$(ID$8H$HG`D$HHD$0HD$XD$hoGxHD$@HL$Ƅ$HD$H)$)$AEL9t9H@H{1Hw@HtH}LHAƅt>HL9uAH$dH3 %(Du=Hİ[]A\A]A^f.L1ɺ1H5)J8BAVLA1AU@I7 ATH5USJH=#EHt HEH=EHt#H5[H=EڽHEH=ЀEHt辽HEH-AL%AH]HL9t$fHH谷HHL9uH=~AtUH=nAH=2A-H56AH=AjH=#AH='AEu5[]A\A]A^@LO H5I@Lpt\I]pImpH9tL%8fDHH9tHsHHLuM1ɺl H5O*IL1ɺh H5&Iff.@HHcHwHf.HGh HAWfAVAUATUHSHoMhHdH%(H$1HE`D$XH$D$hHD$`HD$xHD$pH)$)$$$oExHD$xHD$0Ƅ$Ƅ$H|$0)$)$HD$(L$8D$H芿HLPIH@LHD$HM:ML9IF HLMHD$ IhI9tHfHJHH;y@tHL9t*HHH9y@uHIIH;\$HIhI9uAHAt$HL$T$]HL t$$I1VHL$ H5QT$01R F4}EH P'}ELLIH|$ LIyHHH;\$GHL$I9Ll$`fHCHx@HvuHt]P@, LATL 1H5S)FXZHH;\$HC1LoA)$oXA)\$HCHp@?IHsHxh\HL1 PH51L @EAYH}LAZHT$(%MoMwM9ULtuMmM9HNj@du$?HHHDHfDHHH@ff.AUATUSHI@@4IhL#=9cEHuA@ cEHhAąHHHHp詠 IHMHhHH臠 HnHHxEHRDpLHt$HH|$@3oXZH[]A\A]DIHC1ɺ;LH5LHH1+ǃ @L+1H51j+H[]A\A]DAI@1ɺ5LH54LHH1 +ǃrf.L1ɺD1H51*H[]A\A]L1ɺAL1ɺG1H5*f.L0f.L91ɺN1H5bO*Xf.AVAUATIUHH5"jSHH0dH%(HD$(1HD$HD$QHT$H5iHID$HxPHt$谫IHE11H1L*ÅXH5KH9ÅHT$H5iKH[ID$HxPHt$>IHI$pH5THÅMl$XID$LLM$hHhX!Å\fH5 HA$xI$xA$A$A$A$\t%HH5HÅzA$H5H$t*I$H5HÅmA$H5Ht*I$H5xH|Å`A$H5eHt*I$H5JH?ÅSA$H5:Hmt*I$H5HÅFA$H5H0t*I$H5H5Å9A$ H5ٻHt*I$H5HÅ,A$@H5Ht*I$H5HÅA$H5VHyt*I$H5;H~ÅA$H5!H7HT$H5H[HT$ H5H?ID$&H@PHt$Hx ]Ht$ I$ID$H@PHx]I$CL`HHHLTATI6H51%_AXHL$(dH3 %(H0[]A\A]A^ÐID$HL`HHLIAT3뗐ID$HL`HHLWIAT?fL 1ɺ<1H52%Vf.ID$HHXH9LSPLL$H511$Y^L`HHHLIATBDLa1ɺP1H5w$fID$HL`HHL/IATIfID$HHXHOFLSPLL$ +ID$HL`H!HLIATVID$HL`HHLIAT\ID$HL`HHLIATbID$HL`HHLIAThxID$HL`HaHLYIATnHID$HL`H1HL)IATtID$HL`HHLIATzID$HL`HHLIATID$HL`HHLIATID$HHXHqHLiSI1H581#"XZXHXHH0HL(IS0SHH dH%(HD$10 EXEt%7XEHT$dH3%(H [DHL$ LL$HߺLD$H5pCWE{4WEtQT$ t!|$vWEWE@L1H5'!@1RD@SHHBt [Lo1H5 [ff.ATIH5KUHSHhLHPH1NHH5:LH@HPH1ÅpH5L1Å3  @HH/H!H5(L1ÅHH5$L1ÅL=1ɺ1H5fS"L1ɺ1H5B/[]A\L11ɺH5[]A\fDHH5 L1HÅfH5L1ÅL`1ɺ1H5vBHH5L1Å~NfH5L1Å'H5\L1iÅH5DL19ÅL1ɺ1H5jf[]A\@HxH5ZL1Å>fHH5@L1ÅfHH5%L1xÅfL1ɺ1H5f.L1ɺ1H5kf.LY1ɺ1H5o;f.L)1ɺ1H5R? f.L1ɺ1H5"f.Lɼ1ɺ1H5f.L1ɺ1H5{f.Li1ɺ1H5Kf.L91ɺ1H5bOf.H11?QEHff.@UHHSHHHH<HHC(HHHCHRbAHC rŅt3LK(1L`1ɺqH5H[]1LG1ɺpH5r_H[]fD1L1gH5=*H[]Ðff. AVfAULATIH5YUHSH0dH%(HD$(1LAEAE AE0HD$HD$HD$HD$ &HT$H5\YLJHE\HxPHt$.IH2E11H1H ÅHH5L`ÅHT$H5tLҼÅH\$H HAH޺LHH5LkÅqHH5LKÅHT$ H5cLMHE_H@PHt$ Hx-OHHoH52LνPHT$H5LHEdHxPHt$֙IHH5L{t HH5sL聺ÅmH5LHt'HH5LNÅhH5Lt'HH5qLÅ\H5dLԼt'HH5JLڹÅPH59L蚼t'HH5L蠹ÅDH51L`t'HH5LfÅ8H5L&t'HH5L,Å' H5LHELuXLHHXMtIMXHLÅ>@HhHLHLDUI;1H5XZHL$(dH3 %(H0[]A\A]A^HELHhH螻HLIU8HELHhHpHLIUFgfL1ɺA1H5Tf.HELHXH>LWSPLL$H511AXAYf.HELHhHHLpIUZfHELHXH萺HLISNzfHELHhH`HLHIUKWfHELHhH0HLIUU'fHhHLHLIU_E1HELHXHιHLISbHhHL褹HL4IUhHH5L谶Å@HELHhHJHLrIUpAHELHhHHLIUwHELHhHHLVIU}HELHhHHL(IUHELHhH蒸HLIUHELHhHdLWIU`HELHhH;LVIU7L˲1ɺ1H5&HELHXHLkSPLL$ HELHhHL2QIUSHHzN7t [L'1H52[ff.SHH dH%(HD$1 GE{GEtHT$dH3%(u~H [ÐHL$ LL$HߺLD$H5MHPHH5HeHHPHx tWHUHHZH臭HLSI1H5-E18XZHD[]A\A]1HL裭HXH3HA[D]A\A]HEHHhHHLUIxH51Y^DH[]A\A]@HEHHhH訬HL(IUDHEHHhHxHLIUf.HEHHhH@HLIUfHEHHhHHLIUf1ɺE1LH5sfHUHHZH谫HLIS$fATIUSWTHLHPHtaH5L1蠯ŅHXHt:LH=L€HxtHLfD[]A\@H5L1/ŅZL~1ɺ1H5fHtvHH5L1ŅL11ɺ1H59GgfL 1ɺ1H5?f.L٤1ɺ1H5f.L11H5DUHSHHGH@ HHG^HEsTH@PH8 L1ɺ@IH5;1GDHELLPMt!L1ɺI1H5HXHtHxHt1H5 HL11[O]H5f@)RHf.H@H[]D1L1ɺCH5IWL HL1ɺFIH51SHH/t [L1H5[ff.AWAVAUATUHSHHHD%58EdH%(HD$81EtPHt8E8EO!ЉD%7EHL$8dH3 %(DTHH[]A\A]A^A_fDHL$LL$$7ELD$ H597E(DL$D$ EAL5@Ll$0H,$AMLH\$MD%E7Eu(}UD$tB96 D] EsH@I9VDeD%7Eu}UD$u9r uӋD$ 9EwLM1LH5%D %6E@1ҾHIHttL` MtkL54@fMl$A}@Md$MtFA<$tL L91H5Md$Muf..6E6EH-@LL-*Љ6Ett"f.H@I9MtuHEAUL+1P1L H5 _AX5E5ED$ T$$L@1H5a5ERP1A]A^MfH-٥@HLnu E %5EH@I9uD$ 9E}(H5H=HD$( Lm(Ld$(HHu@H|$(L#HbHٺ LLHuH|$(HtCf8L p1LKPHlIPH51Y^H]H<$HHE8IH5YL+HHDHH52H@P1>E E[ 3EA\I9fDH,$H\$fHHE1ɺPL 1LH5AYAZSfDL1ɺxH5P@ML<11CH5vH|$(HH]8JIL 1PHLPH51)XZf8L 1LPH>PA,ff.UHSHH tHHH[]fDH1[]AWAVAUATUSHdH%(H$1IL$PHtIIPMB uTLu11ۺwH5 .H$dH3 %(H[]A\A]A^A_IPH1ɿLBHH5LJHpH{1IXZo~A`H$IIL@^IEu!LB HHH$Htkb %Ht$lLI~D$l!H $L IH51I1HHp;n HD$H-IM @^MuI0:I~17LIH5t1MI~T$HLT$I1H5.R;A[XL1ɺH511 I~$HLT$IRH511AYAZfI0II(MHH9INfHT$pH)$H H5)B0)$)$)$HDŽ$HB@HIP)$oIhoAxI8)L$pH)$HDo)$oYI@)$H)$HD)$o!)$oiH )$HD$ HH$H cHH59THD$(HE`EfHXIPHL$HD$HHH5HH HL$PHD$H@HHKH@Hl$8ILl$@IHH\$HHLHDHD$0HL$XHHM/Hl$0Hf.HHuHLuMMuHl$8D}TI0I(I IH\$LVHLELD$HWLVQRPt$Ht$HLL$HLD$hHL$`HT$@H$4H@Å\@I~Ht$1HL$H$OH$L7I1RHt$VH5AWHL$ QH N@I1Hi HD$ H%I1HHpi HD$(HL1ɺ1H5HHLISH\$HHt$1Hl$8Ll$@HRHD$HHL|$0Hl$Ld$0Ll$8Ll$XHD$HhHtDDH]MMLIIt$H~HuHmHuHl$E`Ll$8Ld$0}TI0I(I IEIPH\$f.H~}TI0HD$I(I H\$ILy1ɺ1H5\LS1ɺ1H5[i6H|$H53HAHD$P+L1ɺ1H5Lד1ɺ1H5HE H1ɺSLH5p1SLL$pH H|$H|L`1ɺ1H5hvCL51ɺ7HH\$USHHHPDHEtLtTH[]@ǃHH{ H1ɿjI1H5L]eL^_uǃLHH{H1 Hl1UILC1H5jxXZH[]H-HPH H1ɺ_UILH51(AYAZff.@AVAUATIUHH5SHHdH%(HD$1苖1H5HRHID$HHxPHrIHH50H:Å01H5q0HHID$HHxPHBrHE11H1L7Å=ADŽ$`H5H•Mt$H5I~HI^XHH2HHLHDI^XSÅH5-Hj*I$HH5-HkÅ6A$HID$HHXH葕E$HSLH53P1C[1]GDID$HL`HEHLATI1H5XZHL$dH3 %(LH[]A\A]A^ID$HL`HߔIٹLATPH511A\A]DH5XH)I$H59H躑ÅI$ H5'H虑ÅI$(H5HxÅ9I$0H5HWÅHH5H莓t_ID$ H@PHx"I$8HHH5H萑ÅI$8H4$y ÅH5kHImX4 fID$HL`H_HLIATHXHH4HL,ISNfDL1ɺ1H5f.HXHHԒHLISfDID$HL`H蟒IٹLATPIfE111LLZLÅ50fDI$`H5HَÅID$HL`HHLIATL1ɺ1H5fID$HL`H译HLIATeLoH ID$HL`HjHL*IAT ID$HL`H:HLIAT Lċ1ɺ,1H5ID$HL`HHLIAT ID$HL`H贐HLIATjID$ H@PHxI$@HHH5:H+ÅI$@H4$v ÅID$HL`H%L!QIATID$HL`HLARIATID$HHXHΏL7ASISID$HL`H螏LVIATYID$HL`HsAPILWAT-ID$HHXHGLxWISfff.AUATUSH8dH%(HD$(1HHxHIHH5LHPH1ÅtpHH5tLH@HPH1Åtr`H@^HL$(dH3 %(H8[]A\A]DL1ɺ@1H5 DLو1ɺA1H5DL1ɺ>1H51bH5ʾL1Å1Ln1ɺD1H5v!HH5L1ёÅLHÅHH5fL1蚑Å H H5YL1xÅH(H5&L1VÅH0H5L14ÅH8Ht8I(L>r ÅLH5L1ÅH@HH(Hq ÅtHH5L1訐ÅL1ɺZ1H5 LɆ1ɺL1H5ѻ|f.L1ɺG1H5Lf.Li1ɺJ1H5qf.L91ɺM1H5AOL1ɺN1H5)L1ɺO1H5LDž1ɺS1H5ϺzL1ɺY1H5TL{1ɺT1H5.ATIH5UHSHLH@HPH1ŽtvHH5LHPH1袎ÅHt"wqH5-L1vÅLHÅ[]A\L11ɺH5[]A\fDH}/HLSI11H5cqXZ[]A\1L'1ɺH51?[]A\L1ɺ$1H5(f.LɃ1ɺ1H5Ѹf.AVAUATIUHH5LSH_O1H52H&HID$HEHxPHidIHeH50xHÅ1H5xHӂHID$H"HxPHdIH:H57 H軇tGI$HH5 H0A$HPuID$HhX;@HL5Å+LL@ÅFLLk?ÅID$H[uQLGDID$HL`HeHLATIH5 1Y^[]A\A]A^ID$HL`HIٹLATP1H51_AX[]A\A]A^DID$HHXHdžE$HSLH5n1P1wXZZID$HL`HHLIATHXHHTHLIS6fDHXHH$HLtISfDID$HL`HIٹLATPLy1ɺ1H5tf.LI1ɺ1H5Q_Df.L1ɺ1H5!/f.ATIHUS;L HHHOLHC(H4(AHHC@@HC 6ŅLK(LU11EH5sHrHHtrHhHC HLHC(H'AHC 16ŅLK(11LݭSH5 []EA\@LQI11H5ij[]A\1L~1ɺDH5[]A\1Lg~1ɺRH5q[]A\ATIUSHH+H9u %@HHVHC HHPhHEI9u[]A\fAUATUHSLH{HIHzHI9tDH{zHL9uLUHt=Hp{Hc{HL H M,$LI9uefH3{HtHVzHH+1[L8]A\H5A]:f.It L90t0I|$ yHHID$ HrUHH IMLMI9u@H[]A\A]DHczIHHI9u#LpyHTHL9tL9kuAVI1AUATUS螦H5HX HE1L-$@AH[HtO;uVHkLHH5QHtH5FHuIH[AHu[D]A\A]A^ML611H5zsH5tHqu AP@H5]HQuA0@E1[]DA\A]A^ÐH#1MUL1ɿH5'XZM E1L9H5SHGxHt"HH'yHtH[yf[fU1ҾSHH{HHHHt#HÅtXH[]fH;8HHHQHH QH1LH5H[]Ly1ɺ1H51UL1ۺH5j,USHHRH1Ht$H{pHt}11lHHtlI$M$I9u AHL9t9HSHL~uLt1ɺ1H5HH[]A\A]ÐHL(1H5DAUATUSHH.1ҾHǗAąE1D4 1ҾH貞HHX L-H|/1H…u!HLHHNH9t2IL11[H5E11Y4 HkHŅH[H;HkEtHHS1HYDJ fDL?s1ɺ7H5%1UH[]A\A]H[]A\A]fD1L1HH5H[]A\A]DLK1cL!H5H[]A\A]L91AH5b:ff.@ATUS@H1Ҿv萕1ҾyH߉Pې1ҾxH߉ʐ1ҾwHAHDPDHH]Ņ1ҾtH1ҾuH߉T躊HTHH@_Ņ[]A\f.L1ɺ1H5MzH1H5U^HE111H5?][]A\@1L1ɺH5'[]A\1Lp1ɺH5[]A\Lp1ɺ1H5f.L51ɺ1H5mf.AV1ҾgAUATUSHH@dH%(HD$81蕓D1ҾkHɎ(4 '5 4/ 1ҾeH蓎0x/ 1ҾlH1ҾH 1ҾnH:HpH諿110 1Ҿ|HÒ<V/ 1ҾjH角1ҾhHAEHHth1EH@'1ҾoHh1ҾqHbH(L` 1Mt~L5DMd$MtcA<$Ml$LL踽H5L衽tH5WL莽Md$Muf,1A1LH5/f, 3 HrHHsH1ҾiHVH]Hh E1HtaL-e 5MLV11gH5HmHt#}uH}THmA HuDlDH\$|1eH|$HHD$11IٺD$(L H5J8~HD$8dH3%(UH@[]A\A]A^DL1ɺ71H5fH5SL豻uEDHun1MLX1ɿH5^XZfDH5LYt5H58aLFur ]f. fD;fDH=i1ҾfH)@H5ULtH5%L论uJ@̀@1ɺaE1L LӰH5PfH5-LQt%H5AL>u"R@DH5L u MLH11SH5ľL0H55AW AVAUIATUSHHrHtELpHMt9A04HLrLuMDH[]A\A]A^A_fM&1A<$@ILx; ÅInHAH] H|L} H=Lu@u @IH{tAH[HuE1D LH=kHmHjEtLLEÅMvMI~ ufE1M01LʱH5߼Lh1ɺa1H51fL:H5Lh1ɺf1H5iCILgÅt=ADž0M[1LH5IL h1ɺP1H5#ff.ATLLOUHS>HuHcLHEH@HܼIپH=E1{LxvH}IHtOHH=xEsmID$HtaHL:?;uuID$H[]A\DL911H5"[]A\1Lf1ɺH5ź[]A\It$H#Åt []A\ÐLf1ɺ1H5}Vf.S1Ҁ@Hu!1]HHtI[H5PTÅu1L%f1ɺH5 =[fLm11ۺH5ع AUL ATUSHH I9t[IfDHL9tHHs1LŅu1Le1ɺH5iH[]A\A]fDH[]A\A]fDUSHHt>Hu9Lr1ɺ>1H5H-1HH[]HHEH}HpHHHHa6 }tC H=HuLb1ɺO1H5~zIL11JH5R1LDL1ɺC1H5%W!fAWHAVAUATUSH8H<$Ht$dH4%(Ht$(1HD$Hp8gH|$H5S1Ll$ Ld$込HHcfH LLͰHL|$E7EtAH@IE7EtIDA uA#tHt;uWAt <#Lu/#t#HuH<$LHd@H<$LHILL$L11rH5ѶH|$H1u&HH\$(dH3%(H8[]A\A]A^A_Lb1ɺ1H5tLmb1ɺ_1H5Q1 1ۋ8aHb1PLL$1LuH5FXZRzf.AW1Ҿ}AVAUATUSHHzH1ɺHHHH1Ҿ~HH߃ 1҈H߃ 1҈资H߃ 1҈芄1ҾH߉L%z1ҾHHGzD(HEL5'EIE1(蛲IHDH@IIE/EA%uAGH5CH'/H59HH5HH1qHHHt 8yIL11]H5ŷ@1ҾH߽:wS "LiX1ɺ1H5MH$ dH3 %(Hĸ []A\A]LH511#뢐MH5 HuǃXjfDL1ɺ1H5ǶL11H5t覶1L 1L:H5G~Hǃ\)fH @"Ƅ$HH1H=DLEH5FH=D¯L-{IH{LH=DdHHtT1H cDH=wDҺuH5VDLuLH-1D购tzfDL蠭(8<=5DH %HHDHL DPHЋPL%H5˩1RH HL$HLULU1ɺ1H5}说+f.HI1ɿhH5JL1sY^HT$HƿάHf.LH5ܨ1 L$H=ʪ| 1ҾHmHHL%JfHH?DLɟ1ɺ1H5EwfL%LEIL 11OH59@HT$Hƿ螫D$(%=`L1ɺ1LۡH5ڲL1ɺH51蹲HODL1ɺ1H5U臲L1ɺ1LH5(Z8>L1ɺIH51*L1ɺK1ҾHkL$HHL1LH|ILv11H5j蜱ƃ@"\HHH|H8H=ADH 1HHDHL $DPHPL1H5ץ1RH L$1ҾHjHHUH=~H5fH)$ $L$HHD$LPD$PD$%PD$,PD$3PD$:PD$APD$HPD$OPD$VPD$]PD$dPD$kPDL$r1DD$qHpxzLH IL11H5yD DΣH1ATI1LݟH5贯XZLvP1ɺ1H5Z茯`¦fU1ҾSHHsuHH[]If1ҾHqsH߉BuVtL/1H5ԣ1LO1ɺpH5H1[]@HtHtJUHSHHH9u )HH9t H{JtH[]H1[]ff.@AVAUATUSH`dH%(HD$X1+I1H LH#H$H61ҾHgH6Hx 1 HD$H31ҾHfHt4Hx 1Ҿ HcչL0HԺHHLcL#JHH&UHcHH1Ҿ"DuHPqMcuH1HJH1Ҿ$AnHqLc9HJHHH$UHcHH1Ҿ&DmHpf1Ҿ(HpLDHH1Ҿ.Hyp2 1Ҿ/Hcp< HHHH+LH5֫1HL$XdH3 %(H`[]A\A]A^fDH4JHAnLcLH5$SLcK,Ld$HEHHPI9uLK1ɺ1H5ڟ 1*fDL1ɺ1H5תHUL|H5o親t[JHyDuMcmfLdH5'^ f HzIcHHAfDC HHIcHHDEkLAnH5LcǩrfL$H5g螩IfLE1H59kfDL)J1ɺ1H5 Am;Lcnff.AULopATUSHH_pL9tUI-H}LԘt0H{@Ht L还tHL9t#Hk8LH褘uHH[]A\A]fH1H[]A\A]AULopATUSHH_pI9tUIHL9tHHsHHLSŅu1L*I1ɺFH5BH[]A\A]DH[]A\A]ff.AWAVAUATIUSHH/HGHHHF8H9t"L~(IH{(LAŅtHH9uLHA} ?HAv]1MLZH5ByXID$ LZPhHD[]A\A]A^A_f.SH H=}藝HXHHDH H1ҾBk [ff.fSH   1[ff.@USHH=HHt!HH@1HZYxUH=ҝĜHtHƹH=t H[]@H@H[]1L1H5ȚH[]ÐSHH{HtH;HtHGHtH[Ηff.SG茝HHH/etc/lvmƃHHH@H=HHH=HCHH=lHGHHH H<HLtHH@H5{H|LME1ɺRH5.eDH1fH[ÐLE1ɺ9H51LD1ɺ<H5Ҙ LD1ɺHH5|@HHH9HHSLrD1ɺXH5S芣%D1LGD1ɺ4H5-_H[f.LD1ɺKH51@LC1ɺBH5җ @LC1ɺUH5|@LC1ɺNH5蹢T@ATUSH t?AHHtHPHǃ1HŅtDC []A\@LC1ɺ\1H5'DAW11LAVlH5ŖAUATUHSHE Ho11HVHF9HHH}pjHHt豓HDžH L HL9u fDHHHL9uH?IHLMtMd$LMtMmHHDž0HDž8QÅWLMtLL?HMt,LHSHSHHX@Mt,LHSHrHHW_HLHÅR@tH5HÅwHÅLHHHMtHL>HHWÅHÅ[1Ҿ!HjH@"H HHHÅH;HÅMHIÅHÅHÅHÅHGHtHÅH(ÅNDL?1ɺ|H5b虞@LY?1ɺ1H5=oH[]A\A]A^A_fDL!?1ɺH5115L>1ɺ1H5ݒDL>1ɺL>1ɺ1H5םcL>1ɺ1H5豝=Lu>1ɺ1H5Y苝LO>1ɺ1H53eL)>1ɺ1H5 ?L>1ɺ1H5L=1ɺ1H5L=1ɺ1H5͜YL=1ɺ1H5u觜3Lk=1ɺ1H5O聜 LE=1ɺ1H5)[L=1ɺ1H55HLa1ɺAH5Ԑ1HL<1ɺ1H5֛bL<1ɺ1H5~谛I-I~p$II  I[/聉EhI@HHߺHNLFA@H=y/IHH=IFHH=IGHL<LLIL5A@tH5LLILIH0LhXL(1Ҿ!LbI@"H"IHy1ҾLZL L2L\$ LԽLD kLLLIG u1H與AG51~D$ EtLpAIGAo(Ao8AoHAoXAohAAoxAAoAAAAA H0L̈H5L1H5ʔD1ćHL IE1DfDKHH9@At$HLLLH51AEE1XZhHȥML$I @UH@1SHHLDH4H=EHxtH{HH5E[]mDHHIR1L& H5HH1[]ff.@UH@1SHHLmH34H=1EHؒtH{HH5E[]DHH+IR1L H5x訋H1[]ff.@UH@1SHHLH3H=DH8tH{HH5tD[]-DHHIR1LF H5H1[]ff.@AWIAVAUATUSHHH9t?IIA @HL9t(H{LŅuCD9u.I@IH[]A\A]A^A_H2@MLB4H54º1CXZff.@AWAVAUIATIUSHHR L$dH%(HD$81@KID$t1H4H茀HD$ HHD$ 8#HD$H1HD$0HD$(HE}HD$HEHD$I+x#LMw{LLH #LIHuL?2IHt$HG2HD$HtLpHIDzHUHFiISI}Ht$ÿHD$0HIFADL1HH\t$H1HL$8dH3 %(HHH[]A\A]A^A_@Bus~Ht$(H|$ HuIFuFHD$08uLՀ1H51H[]A\A]A^ÐHcUtLuH5@ LuȃLHHHcTuH[]A\A]A^Ð9u@uA $*W+/XfDHAufI9D$3CfDAA\D$ 41T/HAHEft1H;f.HIt$H{HsH;HaIIHAEA9$u(LHLHuMmMd$MtMuHS1M LHzD$ 脸D$ tC1H;Uf}0ft1H;UHffuHcEE1L$1ɺH5踃1AWIAVIAUIATIULSHIp+HHE1ҋEC(AEtuHE(HtlH{ E!} HGtQ,HCMI|$LcMtI_HH[]A\A]A^A_DEuQ H aHcH>L+HC H3A}/,fDA}xуI}HLHHCHC MCH[Jf.T$ I}H{ T$ fH{ HEE!HHH HDHGH{ E!EGDH{ M HcEHG EoH{ E!tpT$ I}1UH{ T$ Hj@HC 1)L|11ۺH5 :.DI\$fDHcE T$ I}1UH{ M HT$ 3T$ I}1UH{ T$ fDT$ I}1H{ T$ L{1H5\茀L{1ۺH5,\PAUfAATIUSHH8dH%(HD$(1H<$H~ HZ)D$HD$HD$ HD$))H{  )HHt$H) H$EtxHHD$HML{1P1H5\XZH<$Ht Ht$̳H{ (HD$(dH3%(H8[]A\A]fHtkHD$HML1PfDLzH5ѷH$HͷEtH,fDHvfgHdH%(HD$1HL$H[at$HT$dH3%(u4H1L?1ɺ H5'W~uff.I1@HHHc:HL tNtJ f.Et+DHHtDȃA ufø1fDSH:H蠴HHCHt[D1LyH5Dt}1[AHH1EDH A f AAt HfD1L[yH5ʵ|1HfDAWAVAUATUH-͵SHHc_(H4$dH%(H$1H HHD~XHBIՋP tII tvH L%@D$ HLQ0ft1f;P@lj|$ @0uM@H$dH34%(H[]A\A]A^A_DHPu@L@AWAAML H{ EM(L*r<1ɃH5b1E1rC(fDML@LH4$H4$A EML?rXH5<HAt$1Ƀ1 rA[[>@ H{ F TfEL fDI(1M9LA#ADHEH JIHEM3L q<1ɃH{ L H.LEELrH5<H11AVqXLZ1ɺIH51E1pH{ HL LDELqH5p<H11AVpAYAZLS1ɺFf.EMLpaH5<11E1=prM L9N@1LHfD H{ H(L ΨLDELpH5<H11AVo_AXfEL ѨOEH5CL gLp<H11AVNoY^AWAVAUATUSH(Ld$`D$ MtNH<$MMHHIHLMMATH|$HH~^_I|$ t$Md$MuŋD$ H([]A\A]A^A_IcD$(H5@HHD!uHًH!%tDHQHDʉ@HHH)HL$HL$`HMLAt$HL$ HTH|$I)MHZY=fD$ 'AWIcE1AVIAUIHATHE1U1SH@HH8H|$HT$ HL$(HD$AD;kcAFt C Pt C BAN}H=HcH>f.S  Avf9s"tC0ft f9X Mf.LD$HL$(LD\$HT$ H|$/D\$HIucLo1QH5~lH8L[]A\A]A^A_@AVf9S"rEtC0ftf9s3Mo{}H|$ILLLHLEHHPH{냐AVf9S"uIVHtX*uC uÃufDAVf9S"dH|$ELLL~ LwLm1H5kkNfDAWHAVAUIATUSHHRLcg(dH%(H$1D$B KL5K@HL { @ftHBHtZB tSHH5ŃHL$_`HL$HHI}IL<1H HYH$dH3 %(Hĸ[]A\A]A^A_DkuL|$ AHپLŅIEh@@t {"Ht$Ņ[IEhƄ$1@tKKHMd@Mt9L\9D$}+HT$H$LIE$hfD@HHH„ L$H5hLQI}LP1RHآVXH HBB KH5A@Ht @ftHBHnB cI}1H7XBfHD$H H&L 1ɺ71H5ohf.L pLM@LۡfDL1 1ɺ51H5GhfI}HHqHL$HHHOI}IHLHy1IWI}H8C_ff.H1HtHAWAAVIAUATAUSHHHtkHx(HHAu`H{ IHDxMtH{L)IEHt8LmDeHHHH[]A\A]A^A_AD$w@LkH5ffDH1@L9i1uH5lff.L1i1{H5<lff.AVAUIATUSHHdH%(H$1HŋtePv]Hf@E1L Lh1H5eH$dH3 %(D]HĠ[]A\A]A^ÐHHLuHDIvH!^AąC%=t7MN1L H5/_eAFgfH}HtHC0AFIHt AM6IFIE)@MN1ɺLH5Adfk[8XMNH }HrELYH5zA9HDHE1PH|;P1RdAFH [ff.@AUATUSHdH%(H$1HË)HkHuHLd$L\AŃbD$(%=HL H$H9C}LM1Lg1ɺH5xc{WLMH w|H9DLXH5AA9HDHDPHH:P1RQcH D1LgH5+c1H$dH3 %(Hĸ[]A\A]ÐHI @L2fL H51b1DLM1LfH5pb#Y8EULMLf11H5(XbHD$H9CtHD$@H9EehYHtgSHu?H@Ht>HxHt5u,L1ɺH5a vH[ff.@USHHHt$H8Ht9(t H[Hu1HH[]f.AUIATAU1SHHHu %@HHHtD9 t#HCHHuH1H[]A\A]HCHt'HEIHCHH[]A\A]fDIAUIHATIUSHTHt_HX HHtHH[]A\A]D8tI|$8HHE Ht$L`L(HH[]A\A]1Led1eH5ؘ`fDAWAVMAUATIULSHH$H|$HL$HD$dH%(H$1stlPvdH@E1L Lc1H5=r_H$dH3 %(DFHĸ[]A\A]A^A_fDAD$`tH$H$LHWIHHt$HLLE1O H$uAD$`H|$DK,7LϦLt$A֋$HA9$LE1BuH1ɺDt$I1H5-LcV^Y^LlPL:VIHE11MTLK/L)fDLtHHމkNHcЅ{T8tԃ tQLH>HtL8HvHDE1otHIHYUPLRH5H1Sz]H LO1E1L;bH5B]DIM9 LAD$`QAoAoOLl$ AoW Ao_0Aog@A/)D$ AooPAow`)L$0Aop)T$@)\$P)d$`)l$p)$)$@9OIUH01!fD@{t tHj@t HDN tHLD AŅLsH1ɿt$I1LEa6H5$\_AXH|$DK7LϦLt$A֋$HމA9$PD$Ao$ILH|$t2AŅu2Li1ɺO1H5O[&AŅt/AH$K 7HLlL1ɺR1H5[1MRff.fATUHSHdH%(H$1HD$HT$Ht$HIXH|$HMd$It$HHE11ɺjHjjjjLD$pjH0AD$H$dH3 %('Hİ[]A\fL1ɺgH5ߒ1 Z1|cID$HtzH ÅIt$GfDI|$ft"ID$]@OfDLi1ɺH5LYLA1ɺq1H5'WYfI|$bL11ID$vH5YRPfATA1HUHDSHdH%(H$1+HH'HH?QuJEO8AAH$dH3 %(HHĠ[]A\fD1ɿ1ILBH5LXHDuIL.H5X]fK}IH pH8HDHLLPH.H5P1RWH H1DLh1H5TWNf.H#HPH@HfDHcE1H HK@HHff.@UHcE1SHHdH%(H$1HH@HHHHЋHHHH$dH3 %(u HĘ[]MAWE1AVL5@AUIATIUHcSH\HLHHdH%(H$1IL{t'M1L[H5Vs I$L#tOHDHI1AV @t'H$dH3 %(u}HĘ[]A\A]A^A_ft[1LAVHTHIAV @ut1LAVLL/DAFLL{fAFpLfAWAVIAUATUSH(HL"H|$HT$HD$MMl$I4$HHtdI|$HHHL$Lx H Mt9A?u#Iw<@uFHt H'uwMMufDMMdL4H|$H'Ht(Ht#HKHPH9@@t o@CH([]A\A]A^A_fDI4$H|$IH^I\$HuAoH{ t"IH3HLC t;L@ LM3LcuH3H=)ufDM H=tL€uH3 H=€t\LH=€mL H= L€tLH=n€0L fDHHQHuHP HQ IGHH@HCIGHXfDIHH@ID$IL`IT$HH2LLLJt0MI1LIItXLIɅuML$LHH2I_HC(M&ID$KHJHHHH9K@gff.@AWAVAUAATIUHSLH(dH%(HD$1HGH$Ht$HD$HsH5HIKH$H1MLJ1ɺ|H5QAD$BbH}E|AEIALd0fLH5?HHL9tMH}H3qHuL L]1HE1H59nPL9ufH<$HtH`@H;8t &HL$dH3 %(DH([]A\A]A^A_ME1L7H5O-H@L5HH$fDH $H={UIAD$H $gH=KYnIH}EHH5?AŅA@L1ɺ1H5E1$OE8CA>MH gH/HDHE1PHfLCPH51RxNH ~@M1LH5aN,EAWAVAUIATUSHVIH7H@AE1E1 DHPAAhu-AEtA tLLLLHt MILDuA}M&tHL[]A\A]A^A_HHtzIEI~H0LHHI}1HLOt Hc롹Lm[|H5:oMLE14H,gLZ1rH53MLE13LlZ1\H5υL LZwH5LdAVAUATAUSHdH%(HD$1AD$HH>I/HJBHHubIIDHLHcH$HDcHL$dH3 %(HH[]A\A]A^fDILZ11۹H5KDLT11ۺH5K{DH?1ۺB4HH5QPL ؅LY1pKY^/fILDHH TH$HuRI}(łHH$HD`I}HIH4$HCHH$BD9H?HLkY4N 1H5oJXZ^LY1ɺH5<qJ2L51ɺH5MJLԄ1H5$JZAHfATIUHSH} t []A\fI$LE1HvH=EPuLH=EHE HtuHLÅI$HH s@LM11LQX H5.I[]A\LaX1 H5́HUHuH/?LL H5 1HH} XZHE ff.@ATIUSH~ HCLXt%H511@H[]A\fI$HtyttH8HC I$IH{ L[]A\@ŅRL1ɺ1H5xGcLeLT8tgHs H덐I$H0t)]LVf.LeL8uDL WfHt~uHHt1Ð[ff.AUATIUHSHHdH%(H$1HcHE1AHH@HHHЋHLHHmHEtMu(H$dH3 %(Hu!HĘ[]A\A]@At$Hd=@AWLcHAVIAUATIUH-@SKHHHdH%(H$1Ll$E1HپLD$ 臷{ t'M1LSVH5Z~Es I$LKtnH1HE @u H]D$ tMu+H$dH3 %(Hu}HĨ[]A\A]A^A_AvLf.H1HE @uHUt LLHI$LHsLLH`;ff.Hoff.@AWLcHAVIAUIATUH-p@SKHHHdH%(H$1Ld$ E1HپLD$ { t'M)1LTH5|CKHD s ILKtlH1HE @uH]fDD$ tMt AvL/H$dH3 %(HHĨ[]A\A]A^A_H1HE @uHUt LLHILLH|@M+1LSH5{B @LLH8 :ff.ATHIUSHHt@LHpLHHHu0HHO[IHSLHHmHtxLHHH t`HtHH@LVH-;HH|IPH="D1HZYxuH{H5 D[]A\x1H@L ZLH|H=DHyLR1h H5IzyA+LR1` H5zLA[1]A\DL ZL$U1ҾSHH7Htb1ҾHHHtKHsIH{HH= D1Gx/H{HH5D[]wfH-Y1LQy H5Ly|@H1[]AWLcHAVIAUATIUH-`@SKHHHdH%(H$1Ll$E1HپLD$ ױ{t'MA1LSQH5x?s I$LtzK1HHE @tMD$ tMu0H$dH3 %(HĨ[]A\A]A^A_DAvLft[LLUfDKHHU @ut'LLUI$Ld`DE]K36AWLcHAVIAUATIUH-@SKHHHdH%(H$1Ll$E1HپLD$ W{t'MW1LOH5*wZ>s I$LfKtvH1HE @tMD$ tMu0H$dH3 %(HHĨ[]A\A]A^A_@AvLft[LLUHcDH1HE @ut*LLUHcI$LHcafDHcUfHc]J4fAWLcHAVIAUATIUH-`@SKHHHdH%(H$1Ll$E1HپLD$ ׮{t'Mm1LNH5u<s I$LKt~HfHE @t[D$ tMu.H$dH3%(HĨ[]A\A]A^A_DAvLD$ D$ fDtkLLUHfHE @ut(LLUI$L_f.EI$L{;fDE+3AWLcHAVIAUATIUH-@SKHHHdH%(H$1Ll$pE1HپLD$ 7{t'M1L@H5 t:;s I$LFtzK1HHE @tMD$ tMu0H$dH3 %(HĨ[]A\A]A^A_DAvLtft[LLUfDKHHU @ut'LLUI$L$`DE]K1AWAVAUATUHSHWdH%(H$1t GH]HEH6 HH9uH $Ƅ$EHUAEHHL$IL5@IfDEL LKH57r<1]9E1H[HH{ uHLHASMLL^_tHcC(HHAD!uLH!%tDHQHDL@HL)2H!%tAM HDHrHD։@LHHsI)L8ZYH[HEEu1E1H$dH3 %(0H[]A\A]A^A_ÃE1ҾH7¸tH]럿<InH H0@LYHu(HL蝬tNHPI9E1LHپWHEH uӪHEHǀ ELgIH5p97EL IH5o7E@.AUIATA8UHSHH?|nHtwH1ҾHH(HLhD`C ЈCu%H=H}HAjHD[]A\A]fK1LH1ɺH5oE1<6HD[]A\A]ff.ATUHSHH}LH8HDHHuOH}(amHHHAQHHHD[]A\H¾HpAąuLH1H5nE5H LYH1E1H5m5D[]A\fLy7E1于H5m4HD[]A\ff.AWAVAULcHATL%~@MUHSK\HLHH$Lt$dH%(H$1[E1HپLD$ "Cs HLUuqH$DHBIHtZH1LLHx貳D$ t H$HH$dH3 %(LDHĨ[]A\A]A^A_ÐKDHIAD$ @HIt$IHH1HHGIG HHHxLLHf.pHCM1LFH5k 3@E1ML$LF1H5k2fLE1gL~11H5dk2)f.AUATUSHHHHHH9tVHAE1 HH%HHޅHEDHH9uHD[]A\A]fHA[D]A\A]ff.SHD^HcHtVH@BvDǘDILEH5ljPHD1h@B 1Ƀ{1XZH[@@BH[fDSHeHt HH@[ff.HG@9tHxH9HGHHuH@ ff.AUATE1USH_HD9tZHpHXIHGHHuH?(IdHt>(Lh H@H@L`HH[]A\A]ÐH[]A\A]1L'1ɺ[H5~?01ff.HG HGHuHHPHufHGHuHHPHuH f9s H@HufScHHtHaH[@L} 1H5}t/fUSHHt1HHcHtLHXHH H[]Ð1L1ɺ&H5}/H1[]fDL1ɺ)H5X}.1ff.fUSHHt1HHbHtLHXHH轧H[]Ð1LW1ɺ&H5|o.H1[]fDL)1ɺ)H5|A.1ff.fAUIATIUSHHH+H9u:HEHI9t'HHsL=%uHH>HEI9uH[]A\A]f.UHSHH?HH9u fDHHHH9uH[]fDATUSHH9t8HIHH9t HsL$u[]A\fD[1]A\ÐATUSHtCHIHHH¸t []A\HH[L]A\vfD1L1ɺAH5;{,[1]A\AVAUATUSHtHIIIH9uT@HL9tHHSLLAŅuL41ɺT1H5zJ,[]A\A]A^[]A\A]A^L1ɺP1H5{z1+ff.AVIAUIATIHUS蓤I]I9u`HL9tPHsLbLLHnŅu1L_1ɺsH5yw+[]A\A]A^@[]A\A]A^AUATUSHHH9tJHIIHH9t0HsLtMtHSIUH[]A\A]1H[]A\A]ATIUHS-L#9u/H]H9u[]A\@HH9tHsLu[1]A\fAWAVAUATIUHHS1H(HT$LHD$謤M<$D$M9tI_M?HM9uD$v HD$HHsHC^HD$HtvHD$M<$M9tPH1fMoLHLIH$L9l$tLt$Ht$HLL$M?M9uHD$H([]A\A]A^A_ùLwH5wa)ff.@AWIHAVIAUIATUSH(Ht$L$TLIYHD$Hu_+f.L)LHpH.]HHLH#Ht$LHSD$uFIA}LLJ, HuH\$HHHyfLLLHtfL1w1H5v,(Ht$Lo\HD$HD$H([]A\A]A^A_fL1ɺH5Xv'볹LvH54v'f.fDfDSHGH1HHH K0[fSH80HI1P-1LEvH5Vv'XZ[AVAULo ATUSHo H]I9t2IIDH}1ALI4HHHM9u[]A\A]A^ATL%g UHSHfHE LHPH+t[]A\fAWAVAUATUSH8HD$pHD$dH%(HD$(1DO0RHI)HAH I LcMHD$LD$u!HJDHtD9-FD8Lc(L蔟I,$H0HD$I|$HLd$ HE腞HDfHL$E(HEE8EEHBHM@HL$U,1ELu0HM8fU(HD$ H{ LtHL$(dH3 %(H8[]A\A]A^A_LAIl$(HI HHHӔM9tIIwH{H;s u1AfDH$dH3%(u(H[]A\A]A^A_fDH=j1ff.ATLg USHoHw8g0Lm@zC8t[H}XL]A\ӓc0H[]A\G0t AVAUATAUSHoHLoLusDHk(C0HH[]A\A]fD^DLi1ɺn1H5d11Li1ɺHC(H5dH1HH[]A\A]ALd11ɺ}H5{d<H1RHH[]A\A]@S0HHt4HrH{ HHHCHHCH>HC蕍H[AWAVAUAATIUHHSH(dH%(HD$1RH=DAE[Lh1ɺZHRHDH HH!SIHE9DH(DAGIFMf MfHAVLIF8AF@HD$ÌI~X躌I~h豌I~x訌I蜌11ӱIHI.L|$IdžH|$Idž5DH LIdžHIF HI袱LE1wHL$dH3 %(LVH([]A\A]A^A_Lsg1ɺUH5Jb1E1봿zLg1ɺPHDHNf.HT$HHT$FLHQHT$HIF0AIV(IIfDIF0H@H4LL~H ILv5I9uDHDHHDHH9uIF HLE1(Lf1ɺ_Hl ff.HHGGATIUSHH HdH%(HD$1t$ Ht$ HHT$HV 苰t'H<$t HD$dH3%(u?H []A\C9C@s1LHHtă1H<ff.AWIAVAAUATMUSH8dH%(HD$(195D]H1EAVH5_LeI$Y1^H\$(dH3%(H8[]A\A]A^A_Ðt$HHt$HHT$ HL$HV hT$ Ll$ME]4EAE0AE0M} t'L5IELH@ HPAE0utIEh<L D$ tAM0LAU8A}<1LD$ D$ DDD$ ELDH0IHgH1!AE0t"H-fIEHH@ HPAE0utIEh<I} 2+Dy@AE4uC8AE4M,$LAE0t!DT$ ErmDL$ IEEt6AE0th<M} L茇L$AE0\IELb1ɺ 1H5)] ( SG4H}HWG4uj8C0u[DI(\(H{HGH+w<w@HAHHHHIHI9sH [HHHIH)f1LobH5k\1 C0prfAULoXATLghLUHLSH茇@L蠆u3H]hH@CuCuH{LmtHLYH[]A\A]fSG8HuqHYHH{(H{0wH苪HC HHZH=DN[HrDpD1ɿ1L[H5)[ HnL1ɺH5Z Jff.ATUSH HdH%(HD$1t$ Ht$ HHT$HV 螪H$HtyC0t$L% DHCLH@ HPC0us4uqt;H(C0t!L%HCLH@ HPC0uC8u*HRHL$dH3 %(uIH []A\1@HsD 1ɺ/L_11H5Y ZYfAUATUHSH8HdH%(HD$(1Ll$H\$t$Ld$ H~LHLHD$軩HsLLHHH<$HD$莩$uHL$(dH3 %(u&H8[]A\A]HLH薨$ff.ATIUSH HdH%(HD$1H\$ Hl$t$ HUHHHH$I$HH HD$dH3%(u H []A\rfɸ5gDDHUD KDff.95>Dt.DHD DAUAATU1SHHcDHH~+H5D>tyHV1HHztc9uufLH=DLHtLHJ HH9uHDL-Dw1D.H[]A\A]øLWH5#Wf9=.D~HDHcfS19= D~xHDHc4[A1L\H5ViAWIAVAAUATIUSHH(L/Lk1LH HHHHT$O1H HHH1IIJ;HHHL$Ht5HLLT$DH)LL9IGIAT$LT$tZMBI)ti1LDLHJILHAT$t-Mt@ID$H(MHD[L]1A\A]A^A_DH(1[]A\A]A^A_H([]A\A]A^A_@HDLLT$LT$LT$LD$AVAUATUSHdH%(HD$1H9tkIAHHIf.H<$HH9t>I<$MHDuHT$dH3%(uH[]A\A]A^fD@AWAVAAUIATUHSHHH?dH%(HD$1jH L9tyII3fH$HsLHHxLcH<$I9t>H;MHDuHL$dH3 %(uH[]A\A]A^A_Dff.AUMATI̹USHHH?dH%(HD$1Iyńt)HsH<$HtLgLLWLkH<$ZHL$dH3 %(u H[]A\A]XATMUH͹SHH?dH%(HD$1IÄtH$L1HxHH<$HL$dH3 %(u H[]A\f.AWAVAAUIATIU1SHH(dH%(HD$1HGHt(I<${H HD$L9tuL|$.fDHD$HT$HHxWH|$-I9t@I<$MHDuHL$dH3 %(uH([]A\A]A^A_fDff.AUMATIUS1HdH%(HD$1HGHtH?I~ńtH$LHxLH<$iHL$dH3 %(u H[]A\A]gAVIAUAATIUHS31H HHJl5HH1HHHH9s#HfHDLHH9u[]A\A]A^AWAAVIAUATMUSHHHH|$t$HT$dH%(HD$81LT$HDH HHD$ LH1HLILLgLT$1H HLH1HIDHHHD$(H9HD$0HD$NfHL$ Lt$0LL)IvH9HGLHE1HILL)MH;l$(t;LD$t$1HH|$uHT$8dH3%(uHH[]A\A]A^A_ø@AWAVAAUIATIUHSHm1H HHH1HJD-HHH9tIIŽE1fDHDLJADHL9uH[]A\A]A^A_f.fH8dH%(HD$(1HH<$HHD$HHD$LD$HT$(dH3%(uH8DH8dH%(HD$(1H1H<$HHD$HHD$HD$HT$(dH3%(uH8AHHDD$ dH%(HD$81H,H|$H|$HD$H6HD$ HD$ HD$(RHT$8dH3%(uHHAUATUSHHL#H9|IH-$TIIU8sI1H5"THIH I%A кP1!HsH=DXZ/sHLdwI$M9uH[]A\A]AVIAUATIHUHSHK<4HIHRJ<3LHA@u1Et[]A\A]A^f.Eu u1A []A\A]A^ff.AWAVAUATUSHH $HH $HXdH%(H$H!1IH=DHHtBLGH=DHG9t% %9L-qDLLLHH@u~HLH.ulH XHHLAǃ}EH bHHLxAǃ}(H 1ɺjIH5=14AL$`fDATUHH=DSHڵH={DHI[MHIH@H I A@t~I95H@8LAHHH % H5S<QP1UR5nH HLZÅ[]A\@LH UL =1RH5;_H=DAXʹIH1H=DLL@ÅHLÅ[Lt1ɺ1H5d;:DHe]UL_@1RH5(; IY^LH7ÅL1ɺ1H5: L?#1H5:H=EDL[]A\fDHXL1ɺIHH5g:119@H1IĨL?ATH5$:URHH L1ɺ81H59M@H@8LU?HHH % H59QP1URH=BDH wIHH=,DL蚲ÅHLpÅL/1ɺ)1H59EU11L>R=H58XZ[]A\HIHYL1ɺCATAHUSHHdH%(H$1HH)1D$%=@tQ=`t*H$dH3 %(GHĠ[]A\fHt$(H3fHH޿ xtD$%=HɺDH9$u#ExHhDIٹL=H5712@C8I1ɺPH7LP1H5Y7X1ZfD8TI1ɺuPH;L׷PIٹL<SbfAWAVAUATUSHH $H8dH%(H$(1H\$ IHHD$HRD$ HH1u/1HHt-MtLH=#DL[HD$(H*IH=D:IH H=ײDHH=DHD$IHHT$HXHZCaLLRK`HHYAHme81LLPH01H5/PLL$01XZ+[$H|$MH0H1MH|$L$@0L>1HL$E1fDH蘣HHAD貣HHu H$ dH3%(H []A\A]A^A_ËD$HcT$H=DHHH H H%H ‰I HtPHp(fDHT$ Hw@H=qDD詡HuL$t$|$ALɺLL$"tLL$LLHWbf.L011ۺH54(ZD8uv@1H5'1PHIPL1Y^ZD{8$IH HvHDH1۹PH)LPH5p'1RH DAWL0AVH50'AUATUSHH|$dH%(H$11שDB6HD$D$L=ƩDHDI9HD$0HD$(@MwHT$(LRHD$0HvDD$zH|$hHHH5(HLl/HH\HHLt$Dl$L|$ HH|$HIXIH|HH;1H!A!LIHu#`@1HLA!CIHt?LHuM1ɺ*LX/H5q%LIHuL$HHH0HLt$L|$ *Eu-MM1L'/H5%.fDM?HާDI9-HD$@H$dH3%(H[]A\A]A^A_f.M1ɺ#L2.H5$fML-11H5V$|L- H5($1LHLMLQ.QH5#fD8H1ɺEPML,H5#1ZY@L>%1H5n#:3FHHD$D$_@[fAWAVAUAATUSHH=DsEHHE1L5-H=DHEHHH=nDHEH@HŅxDxDHAH-MAWI1H5"XZEtH|ouLam1ɺ0H5N"y\@E1HD[]A\A]A^A_ff.1DH=DATUSAąH=DIDHHtH=DHt>H= DHt>HD1HH[]A\fDAL+1GH5 !1@H=DHbsff.AV(AUATUSHH="HRD5H>DH xK=H,DH1=HDH=HDHwH=D HDH H=ĢDHآDHH=DH@H͢DHLH=բDB1ҾHHD6IHbH@ 1L u PHc݃H@kHuH=!IHHHLZ+IH^Md$ HMu Md$HMIt$L)HHuٹL=+H5L'fH=iD1Li1ɺH5H=D1[]A\A]A^DLi1ɺH5n[1]A\A]A^fDL , 1L)1ɺH5:`fL<)H5.[1]A\A]A^fDL)1H5Lh1ɺ1H5룐LH5{fLih1ɺ1H5YDL( H5+V#H=DLH؟DHtLK[Lj)H51LAWAVAAUIATIUHSHH=DDdH%(H$1t;HH@`HF@HHH@D$%=`RHt$(H;s8H?Mt 1HLLA$VH$dH3 %(HHĨ[]A\A]A^A_fHHPuD$%=`ELxf1ɺ1H5h{fH=DDLt$(HI$LHS8AH IHAUI IL (H5QA1AVPHH % кP1H0H\MH\$(LIW8HHHUH IсIL' AH5`Q1SPHH % кP1mH0LHt$(H4H=DH8HHI1L0H5 DIL1ɺH511DILN&1ɺH511DHXHS8HIPL=&H5IHHH % 1P1RNH=DH H[8L#L9u #M$$L9tI|$HjuLn<H1tHLD&bIH51K` DHphL'&It$(H=DPIHtQHT$(UL%1H5-HIH I%A к6P11XLZHt$(HH=DH6HHIL1LH5ILF$1ɺfLyb1ɺ1H5i|f.IL#1ɺL3b1ɺFH5 K8聸Bf15DATIUHSH]Ht'HѐH}HHEHEHtC`tH[]A\f.1HHLtS` tfHhLL$IH5]1K` H[]A\fUHSHH=D7HtBHDH@HHt(HHH5tH[]DH1[]AWAVAUATUSHH $HdH%(H$1HHHT}1L@L$1LHLD@Lc#ILL踷1H@2ILHAH$dH3 %(D&HĨ[]A\A]A^A_fD+@1Ҿ1ML1EH5V|@LL211AELL轶HMKE1LH5P1XZH$1H@HHHH3H@2HL!RH5@1E1aZ@1Ҿ|1ҾHwHHs/AąI61L H5@L*1ɺ 1H5Ǽff.fAUATAUSHHtGrŅHEt Du H߽r2H[]A\A]DKŅtHp7ŅH@2HKH??ŅuH7MH=Ln 11H5y蟻H?0f1LW\1ɺcH5IoH[]A\A]f1L'\1ɺhH5?H[]A\A]fE1HAADc>ŅtmH8AkHk>^fDHt 8L1ɺ}1H5豺DL!1H5V|L1H5&LHSH=HtH=Hσ kL@2L1tH5ȹa1DfATIUHSHdH%(H$1FÅ4HḺD$%=`tTM.LH511 H$dH3 %(0HĠ[]A\fDHt$(LÅH=:DLz-HtHH.fDÅH3H;ÅHEÅH;fDLX1ɺ 1H5 fLX1ɺ31H5 ߷f.LX1ɺ1H5 请f.M)L[gLQ1ɺH56 aDLI1H5 ,L1 H5 Ht:LW1ɺ61H5 Ƕf.AUATIHUHSHèHLHItFH=LÀۅu8-L#HtHxLH1ͦH[]A\A]H1ۉ[]A\A]fAUATUHSHHH9tCIA HH9t0H{ HtfD9cuLuHH[]A\A]fDH1H[]A\A]ÉAT1LcUHSHHHt Ht 1HfGt=H#HtnHP@< u"J #H9rQH9tEH< tt6< t2J<#H9v)H)1< tHH9t D D uBD%[]A\ff.AWAVAUATUSHH $HHH$Lf8MHt$IHH\$0DD$IEHD$dH%(H$81HD$(HD$(HD$+HMMAUI AIAHHA A1HLZYLct$Et]HL$LHHtfHD$t[BD5H$8dH3 %(HH[]A\A]A^A_1LHH(t }ufDH|$(u(HT$Ht$I<$譯uLt$(fD1yH|$LrIH5n11@SAUATUSH%=ڬD-ЬD9AAH1ҾlHHLM1HH=zDeDD W@EADAAL1ɺ 1H5;fHt DH[]A\A]fDA1L\1ɺ H511H[]A\A]DBH=D1踥Ņ~Dt-:V@D%zDjD1ҾHHD$LkHL$HIL$R1ɺ 1H5:D軧1L1D 1H5R0@DLQ1ɺ 1H5ϰf.LQ H51衰@#1ɿL]D 1H5ou10@7LQ1ɺ 1H5~1ff.@HD@HtÐHH=SРtHH []A\A]A^A_@HIHHD$(!I@21ɺ-1ILH5>HH5.H\$0IHL$0fDLH蠏H|$0#tHH=HH=|H5H赑H5HH裑IHwHnH5zHH5sHHD$ kH5dHHD$W8HD$3HD$HuLHu$0LLW$0t<.31HD$ Ht?HǺL'$0t#<.tL_HL$HHA(DH|$t@H|$L$0t"<.tLHT$HB0H@H|$t@H|$L$0t"<.t 1LHL$AHt$H|$(@H5uDH4L uD11Lt:H5講IHH5uDHݒuL nuD=guDHLDH>1UL1ɿH5FXZ/HߺH5tDL tD11LDH5DL(&1L;1ɺH5 迚DL1VHT$HHB @L1ɺ)H5q@HD$Ht>HǺL$0<.t"t 1LHT$BL1ɺy1H5LH|$uL(HT$fBf.=sDL sDH-ADL1ɺTH5葙|@1L1ɺ0H5g1蛐ff.ATUSHH $HH5)L%H@2H$dH%(H$1ВHH4@HH耊H$#tݹHLuHHHߺHHqDH1ɺ]S1ILH5dHH詏ZYH$dH3%(H[]A\@H`t1L81ɺfH5H1L81ɺY1H5ϗ#f.1L1ɺOH5蟗1IӎHHH9uHH9tfxu1DHHH9tH;pu H9pt HH9u1ff.HHH9tBfHP0Ht(H LBH3L3FI uHJLBH3NL3FI t HH9u1@ATUHSHH9t"IfH{(Ht Lύt HH9u1H[]A\fAWfMAVIAUIATIUSHHHdH%(HD$x1Ht$4)D$P)D$`D$pHD$8D$4cHŅA$0u6HL$xdH3 %( HĈ[]A\A]A^A_fAoMAoU)L$P)T$`MLAfMt=LHHD$8HML11H5x+AHLHHD$8HML11H54HC8I$HHcJ %H9HcJ AH9t!Hc AH9tHcRAH9AfDfAAEDAHLBHD$8HtHL{ Ls M9t#fE;ou @fE9oM?M9u(H$H$HIrfDhHLHP HX K`HLL{0HD$8{LIHD$PHH$HHD$gLHIW AwLHD$vHD$MtHI}3HI(H1ɺjAVI1LAUH5t$8H HD$HtaHxLp0HHtѩHHHT$ AVHT$(1ILnH5*1Rnt$t$͒H HD$HtsHH HxHDpHL$ Ht\HHHT$(LH1ɿt$(I1L9AVH5HT$@Rrt$0t$(PH0HD$HtaHxLp(HHtHHHT$ ٨AVHT$(1ILH5B1Rvt$(t$H HD$HttHxH9tkLp HOHMLDHtkHHHT$[H1ɿAVHT$(I1LH5R{t$gH HD$HH@H9HI$HT$@HjI$HT$HAHD$HpLAHD$HxHD$HH9D$@蛧HMw HD$芧HT$L1IRAVH51螐^_ML HCE1IHVCHD$L艂H!AV1t$I1LXH57XZI} LI}(CI}0:AGI fAE跆HIE 軦H裆I]H<$IE(蒆IuHIE0҇I} I}(I}0I$LlLW01ɺH51mL)01ɺ1H51=gHtI HH$kH$H'fLxL/11H5$׎fHD$HbPfA;WtoHLIHD$Hp Ht#MLLL$ՅLL$Ll$LL$LHjL4$LL$HD$@I IHD$PT$ HDt$4HD$פHLT$(IH5<1RHL$(Q1AVH =fMLN11H5謍A$LAMw HI/H1ɺAVI1L.AUH5t$?H 8,IHL-1ɺ1H5L)f.Ll$8HLL] HT$8ApDMw HtH1ɺIAVLUH~LQ-11>H5gfHD$HH9XHIH0,Mw E1HD$DLxLHT$8fDHD$HxL1ɺ1H5ы>LHL.tkHT$8AU1H=ILL$LL$f.L1ɺ1H5}f.L1ɺH5}@LA1ɺ 1H5W}fL1ɺ1H5|/}f.sL'DH5C1|pLh1ɺ1H5|Irs11HѺff.@%=uZXvDtPJvDStM @ pvDju] @[Ðu= @LS1ɺ 1H5{o @fL1ɺ 1H5{D#rL1ɺ DH51o{ @2@L1ɺ 1H5[>{ff.AWAVAUATUSHH $HfdH%(H$x1)D$)D$ D$0)D$@)D$PD$`<t,H$xdH3%(HĈ[]A\A]A^A_HHIH9uHH9tfxuo:LHH$)|$oz)|$ o~h)|$@o~x)|$PI9%L|$@D$ Lt$LH\$pMI1HfAoHID$HLfAoWLVM-oX o`0KS[$c4HHH@0LM(H pLQH5HHDMLDH1AV+AWP1hyHE fAo.H D$ hfAovpHEHtH@0Htfxt4M$$L;$$D$ t Lt+L1DfAo>H@ xfAo~xL1ɺ6H5xofSHdH%(HD$1D$HT$HuHLQ1ɺ<H5QxD$HD$dH3%(H[HtlHuL1ɺ@H59wL1ɺ-H5w@H8nL1ɺB1H5w9nDAWAVAUIATIUSHHXL$$H|$0dH%(HD$H1H|$u)HD$HdH3%(RHX[]A\A]A^A_fDLA1ɺ1H5<HvLL9D$D$ Ld$MfMfA~wMtLL_AD$b SHH LHHD$ M~0A$:M$MI$IJI3I3OH IBIJI3GI3OH k@Iv(I~HHt$(M蘌Ht$(HmIV(HDI~HHDHT$(cH1ɿHT$0I1LWH5RuuI~XZ*HlHHD$(t(I~(ogHD$(D$IF(HD$M6I9dLLd$L9AM~M#fA~MtLLAGb LtHH LHH IF0H8.D$ AJL*HMN01PLpH51@t^_H{ЫHtLxH|$HI~ Ht ,fIF Ag`IG0D$IFA$@M6I9L|$0L;|$L-xLt$fDM?M9thIwHDHuIFM1ɺIH51fsIW1HHHPI7M?M9uHH9uMf.HH9t;A $u3HP Hc:.ZfxuHxuHx0tA$T$DL$ L11H5rmfDL=%LLT$(LAWLT$01IL1ARH5LT$8ZrLT$8Lh_AXIHI~0UdHD$Mf0D$fMA?.L赈H1ɺAWI1H5L}qI~0cHD$(IF0Y^D$A$H@L8CLI-H1ɺAWI1LH5CqM6AYAZI9s fDIIHNH3H3HH HVHNH3PH3HH L襇IV HIHHT$hHT$IV(HHLHT$gHT$HMLY1RH5Y1npLgAXAYIH~I~(mbM~(D$A$\@LHt$Ht$MN01LImVPDHD$$DL$ u.L1ɺ1H5oHL^1ɺ1H5o^LHALHD$;H1ɿHT$ I1LH5R?MoA_XmDL|$0D$ D$L;|$dJHxMN0AWL1RRH51nA$AZA[fL|$0L;|$fAWAVIAUIATUSHHHt$0L$L$,dH%(H$81H$HHD$LAIH=IIHHƹH=RAAED$H9tzfH{0tif{ubHCHt DHdEtPI~@bHt=LK0E11LH5mMt AEDHH9uH|$D$(t.H$8dH3%( HH[]A\A]A^A_DIZL'1ɺ11H5VL%cm11HHtHLūIHAEbuILLLHtIH LLHtIH LLHtIH LLHnI~HWLhHLCAoH|$H@AoIH(LK0WH舂LPLa1ɺNAH51kL$D$8D$HD$@M9HD$|H\$XHD$ L|$f.L$|IH !HLHt_IH :HLHtBIH HLHt%IH <HLH@H0M$$L;d$tEt$I\$uHLݽHt$ HH0D$8M$$L;d$uH\$XD$@1ɺLH5PD$@PDL$X1kjL$A[]Dd$,ELd$D$HM9Lt$E1MD$=InHH|$IvD$(IHHt fx+M6M9tI~Ht tM6AM9ut$(D$H"D$ELt$AąD$,L$A!Dd$ Ld$M9L-~@M?M9IoHtI1HLHPI1HLHuH:HHD$HT$1MIIGH5\RP1iZYHtHCM?e`M9h|$,D$`L11 H5hLH$H;\$t@Ll$0Ld$HkHt"I~HtHhHL-HL9ù|$ IH5H=aHHX`L1ɺC1H5<gf.D$@fDLx^LHD$ k^LHD$8^^(HD$@_H|$ IH|$8H|$@HDT$,ETH{ L\$L} jYH{(aYLIHD$ L\$HC HD$8LHC(HD$@fA{LIC IkHkM`L]0HsH^D$H$H57_tE>]yH1ɺ\PL~L 1H5vf_AXDL 1ɺ(1LH5FfH$L]IH;l$.LH\$PLLt$hMDt$HLd$`ID$IT$I3EI3UH H}H|$P|H}HD$H|HT$HM1LYH5RP1eXLoZ1ɺH51teM1LH51PeLHIHH;\$HLeHEIT$I3EI3UH AL|$PL{HM1PLG1H5$dL}A_XfDH|$ L\$PVH|$8VH|$@VL\$PLVLa11H5wdwD$ L1ɺ 1H5LdLh1ɺ 1H5s&d}H\$PLd$`Dt$HLt$hHD$H1ɺAWL1LH5cAXAYL\$k[fHpufSHH@=-@tH[fD[fDHLJHfHLJff.SHHHtWHǃ[DUHSHHt HH[]HHHtHHS8bHZHHHStOHHHH[]LI1ɺ:1H5_buf.H1yLBIH51b5f.L1ɺ=1H5af.H@H[ ?HfDAUATUSHHLH@H' ?THHt[LM9t@HHI,xATsLvAUI1H5AaXZHH[]A\A]ÐHHHIwHH5ATIL1p`Y^HH[]A\A]AUATUSHDEtqLMteHH@H1 ?TŅuWHLHI=wAUH5 ATIL1R`Y^H[]A\A]HXHIvATLAUI1H5`XZH[]A\A]ATUSHHt9u'ǃH[]A\t$ t$ uHvH?HL$>vHLATI1H5Q_XZff.fATUSu []A\fH8ŅtHǃ[]A\HHIuHLATI1H5\^XZ@USHH@OMuKC@HLuLIH5e1e^C`u_H[]T84RHHtU1IHPL41H5 ^XZjDHH[]2gfHtLIH51]1HfM@@SH@C`u11aALy {@Px [[bYfG@x-GD~GDtHHD3G@xeSGD~GDHuHH[ÐsLIH51\H [Dff.AWAAVIAUATAUSHdH%(H$1pʼnLD$%$sE^@IExJD$AV`AFDEu |$} AFDL5AF`Et@? >LDں1OAF@AF`E<AFD $|$D‰ƒEAF`@@AF`E$AF`H$dH3 %(Hĸ[]A\A]A^A_f.AFDDIV8H1ɿLH5HIH I%A к9P1Z[]1ifDt/t+1MGLH5giZAFDLAFD6afH5 s MH iH/HDΨL_HDH5HHEHH5QRP1YAF`H [P8HE6AF`@+1LHL$MHL$AF@Af`1MLwH5NUYAF`@fAv@HT$JxIF8H9D$81MLH5XLL1ɺ1H5XDL1ɺM1H5X]f AF`@EtqHML1P}H5P1PXAXAYAN` ML11TH5X/HMPH5L1W^_AN`LHD$1KHL$AF@Ml1LH5fhWA~@1 PIFxNf1ɺkff.1ɺ1Nff.11111ff.AUATUSH(dH%(HD$1HHG`t+HL$dH3 %(H([]A\A]f.II%ŅL$$H-Ll$H߅HoHDlHMULH5P1ATUH 虺u{@HwDHt,Li1ɺH5z|U1fL)1ɺ1H5=?Uf.K8IHHkH1ɿUIL31AUH5ATTH H'L1ɺ1H5TKff.fAVIAUIATUSHHDgTdH%(HD$1HH$D$1E~1H{DB1HT$hDBT$ы$KLCHAAUHL$dH3 %(H[]A\A]A^fŅtH߽hjAbGHGL1ɺLZ1H5uwSD$11TfDL)1ɺ1H5=?S$H&L1ɺH5S7JAWAVAUATUSHdH%(H$1HHIG`jiHDkTIKLd1ɺ]ŅuuD5(?D9shEm1LrDAI$HM1LxH I$HCpDshP@L1ɺ>H51Q1H$dH3 %(HĨ[]A\A]A^A_fhHIpŅuD5[?D9shHLJIHD$0HM1LQH I$HCpDshP1H5QSQXZJG8$EH1PLMnH51 Q_AXH(ŅHgLr1?}I$k?H1H5MH LI$HCpShxP1PYH^a(LB1ɺ{1H5VSPQfDF8,DA}MH iH0HDHL)EPH&H5P1RHOH L1ɺh1H5Of.HspM1LB1H5yOHCpI$A[[sHMsp1LafDE84CHM1PL1nH5OAYHAZŅL1ɺp1H5NFf.ATUSHdH%(HD$1Ht_HIG`t3HL$dH3 %(H[]A\fGPH$t1@sŅ{@1Hc<H$HA$CPA,$dH1ɺUILH51MXHZ0L1ɺH5M @+D8AHIIdH1ATI1L8H5X_M_AXC84AHHcH1ɺUILH5 1MYH^ŅL1ɺ1H5L>DAWAVAUATUSHH HdH%(H$1Hw,1H$dH3 %(H[]A\A]A^A_ÐLIIHLL8$==HLHHu=$=t =\L1Dt$D$\AE9D9H}bHILPAVATTfDL1D|$D$A9tKA9tFH&bHMLPuAWSH5[17KH fDMuf.L1ɺgH5J1Pf.I]8fL1ɺ~H5J1ADHdH%(HD$1HL$t)1|$N+HT$dH3%(u/HL1ɺ,H5N1J1hAAWAVAUATUSHH $HIHHIdH%(H$1M謔IID$8HD$MA}IHcKILH9fHc H9ILH$HI AUAHHA 11PY^gHT$ H޿AH5HBIHH$L@HHD$:HH|$LL1 HHTVH1IHؿH LӾH5P1d?XZDHcH@HcH@HUHH58AVILD1?Y^76ATUSHPHcdH%(HD$H1HF8H%H9t'1HL$HdH3 %(HP[]A\fDIH HHM\ÃuH-UAT1ɺIHpH5kPL"1?>LZH=VYbH=>LB?75AWAVAUATUSHdH%(H$1?/tOLx1ɺH5=H$dH3%(?H[]A\A]A^A_IH5"I147HIHDLH.Ht[$<#tI1L1ɺH5y11D$ILC11H5F0XLٱ1ɺ1H50bf.H|$fGHLAVI!AUH5γ1AWu0H @L91ɺ1H5G0D$f.&H|$D FH5]ATI1AWL(/Y^@L)1H5/H|$l$fDHLL$CLL$6H$0dH3%(LHĸ0[]A\A]A^A_f.ML11NH5!H؋H!ʁ t€DHHHD@H1H) HH9<3 u3_H؋H!ʁ t€DHHHD@HH)fIL3118H56 E1@L1ɺb1H5  LL$DE1Ly1ɺ01H5ɣo E1aL7La1ɺ?IH51; E1-nf.@AWAVAUATUSH8HT$dH%(HD$(1HBfEH8HHt$HHT$AISWAP-SPAISWAPSPACADDD H9A_Lt$ HLHL9d$toM9.HS1SUSPENI9HS2SUSPENI9HULSUSPENI9HV H9D$t%EAw0HT$MfDfA~CEuH|$Ht H1HL$(dH3 %(H8[]A\A]A^A_fA~E2tHS1SUSPENI9IA~DtHS2SUSPENI9BA~DtHULSUSPENI9;A~D0apf1L1ɺ1H5m;Lf.fUSHH $HH_8dH%(H$1HhIHI IHAH$A1A HHi$xEHH޿t[H$dH3 %(HĨ[]H13L1ɺ)IH5ɢ118t/I1PHLkPH51XZ^@S1HdH%(H$1HHt_1f$Ut!H$dH3%(ujH[DHHs@uCEHH9uDL1ɺ]H51D1?ff.@AWAVIιAUIATIUDSH(DL$ L|$hHT$dH%(HD$1HD$T$pDL$ tyD \$`u1LH=ALe1_AXo@M1L'H5Y?ff.@ATUSHH $H`dH%(H$X1HD$ dIHI IH\$PHAA1HA ѾHƤ H5nHH1HtMLd$H@L3 H 1HT$ H5L ugHD$ H$XdH3 %(H`[]A\1L?1ɺH5Ğ1H1H51ATIٺLD$HY^ eO8 I1PH[L&PH5=1XZ%@I1ɺLgH5^@SIHI AHHAAHA 1RH=ZYx[IٺR11L-H51[fDF`fAUATUSHH $HXH_8dH%(H$H1HWbIHI IH\$@HAA1HA ѾHom'H5HE1HHtGIH¾@LHH=LE1AH"ufH$HdH3 %(DHX[]A\A]fDHE1e-L1ɺ@IH581 8\ MI1PHLPH51?XZZI1ɺHLH5D @AWAVAUATUSHH $HH $HH^8HT$0IHHL$(LD$LL$ dH%(H$!1m`IHI IHAH$A1A HHlH\$5H|$HHwH$H- HD$PHD$8H$L%,HD$HHD$@D$HD$X@HpHLpHLtչLLtL$1I@MHL_xHT$`L yH$IHH9Q THH|$8Ƅ$H ȁ #!L=Ht$8LT$H|$(t H|$@HD$H D$ HT$8 H!%tDHJHDщ@HH+T$8HDt$4-~fDHt$8L\H|$t$H|$HuHt$8I} H]JHD$HH|$ $H|$PI}Ht$X -JHD$PH HD$0HtT$HD$(HtHT$@HHD$HtHT$HHHD$ HtHT$PHT$1H$!dH3%(HĘ![]A\A]A^A_fDH)LnkIH5ؗ1!1D81ɺH5PHniL{PLL$1Y^HD$0H1:I}LHHD$@ff.AWAVAUATUSHH $HHt$H$dH%(H$1E H$H;YH$HپHD$ HHui1H|$ H5Hl$0 D$HD$HbDHT$PH^H1HH)|$0 uH8 tHcH 1JIA=vL H0HtEHLz1ɿI1AH5֕AU$_AXEt$E1HL H!%tDHJHDщ@HL)H9r LLuA@IAA?uHD$HLLx M?A?Hl$(UfDAu]IoH H9rHLLau A4MMUA?MwLMMu1ML&WH5m H|$H<$rH$H$dH3<%(H$"HĘ[]A\A]A^A_DHc1|0BD$2fHT2HDP 7H<$IcŃL(&11LH5e H<$HG$H$fDHH9uB8pL1ɺYPHPLL$01H5Q XZMcH=>IcK@TH<$T$1LLH5 H|$9|8Lj1ɺNPHPLL$0`1ML_H5M H|$08oL1ɺaPHPLL$0Hl$(LU1H50 H|$a8$H "HHDHPHLPH5y1RLL$@n H iLGH5A BH$HMcHl$(BL$8W$H ?"HHDHPHLGPH5ӎ1RLL$@ H HHnFbHV8HcO HZHH9HcHH9tyHcOH0H9tiHcOH%H9tYHcOHH9tIHcOHH9t9HcOH H9t)HcOHH9tHcG H9H3!HHD1HcD$f.1 HcD(AWAVAUATUSHH $H_\dH%(H$1IHDŽ$t5AH$dH3 %(DHĸ[]A\A]A^A_ÐLg8HL$HKEH8YHE8HcSH%H9tWHotVUjt`1[]A\fuHH,pHtfDHt[]A\f.HHtsL`H5qLHwHE8HcS H%H9tH5VLHHtNH=,f.L 1ɺ~H5щ!1L1ɺH51L}1H5ff.AVAUATUSHH $HH $H`dH%(H$X 1HHV8IHHH%D$HH % ЉD$ ~uHc|$At$H/u;HE8HH$X dH3%(aH` []A\A]A^fDDt$ Dl$Ld$PMHLHE1E H$PLH]HHƄPCHICMMLHHU17 gH5LIHtLt$H¾@LHHL$ HT$L1H5+ŃD$ HcT$HHH H H%H HLF89M1PHRLPH541XZ\L$ ș<)HHcH H HH H DML.1ɺH5ˆ11DHL1ɺIDHHHL1ɺIDK8L011PH"MP'H5.1|_AXU@H1H5MAVL211DY^rD8|$PMH HHDH1PHVL PH51R,H DML͆11%H5a1SHHV8HcO dH%(HD$1HH9t:HcHH9t/HcOH9t&HcOH9tHcOH9tHcOH9t HcGH9t1H|$dH3<%(u0H[HPtH$HcH%H9,ff.AWAVAUATUSHH $HxHIIIdH%(H$h1rI}HD$OIHt8uRLK1ɺhH511_H$hdH3%(Hx[]A\A]A^A_@HD$`IL$8HLHH$ÅH$H5HIHHl$ LҾ@LT$HqLT$H1LH5 HLT$LT$L+8j1LPHH5PLL$1KXZ@L 1ɺeDL1ɺk1H5f8HT$LLHD$LL$HL$H<$HLLL$eLL$H<$H5OLL$aLL$HIA9t>cL1ɺPHPLL$H51=_AX1I1ɺtPHLPH1ɺULL$LsH511Y^LT$5S8LA1ɺPHQH5JPLL$L[1ɺ|1H5&q ATUHSHHdH%(HD$1HH$RtsHL$$H1ɺIHmPL%1H5ATSLd$ H LH tHT$dH3%(uUH[]A\@Mu 1HhAT1SILT1H56XZATHIH5UH1S1Ht\ 1HH HA$NHE $1UFL1H5XZ[]A\I1L1ɺIH5[A$1]A\ff.fAWAVAAUI1ATUHSHxHt$8H$DD$DL$dH%(HD$h1蒽HAHD$`LHDHAHH5??S$PDt$0L|$(ELH u*H\$hdH3%(DHx[]A\A]A^A_@H5??ELSA LH$HPH tH5}??ELSALH$H`E1P{H AZ@HD$,HH|$HDqAąH|$HHH;H&H HH_H0EL|$81H5^HHD$0LHD$8HD$@HD$HHD$PHD$XHD$`HHD$8At HH=~€fAt HH=}~€AAtHƹH=d~1HT$0H5W~H/'$LL$8HsAUL<1H5N|XZHAED+ 7AHSHHNEAH1PLڇ1EH5{0XZH1LH5}H\1HT$0H5}H>$LL$8BHAULK fDHL$`HT$@HH5}to$LL$8OH|AULxL)1ɺ1H5z?f.H|HD$HH|$01 H|$HIdHT$P1H5|H>HT$X1HH59A(HM1t$P1t$HLDH5Xzt$pt$pt$XLL$hH0D$ LH={HL߆11AUH5yC_AXHT$`H|$L螭H|1E1LUH5yHL1ɺwAUH5py1A[A_D$t LH=z!D$tLH=zD$ $u&HL$0LL1H=-=LL$8Ht@~MVu1f.1HpH9t@1f.DAVE1AUIATL%IUnSHHHIcDLLH1AIHCH9u[D]A\A]A^@DED^E11E1IA uA }SIcEAXHEtR_IcAHDE1DI9t-HDEt A9}A ut'A uAI9u[@Ef1@AI9tHDEt A9JfD1@1DAWHcAAVAUATIUMt$ISH(HT$Hl$HdH%(H$1HM9iL$$H$E1EusAIvHHEH=oE9HH=oHT$HE~@AMt6L;4$AVHLHE~9BI~A AHھEIٹHLZ}1AHT$AHDO=E~AMt6L;4$HDEH$dH3%(DH([]A\A]A^A_ÐAI~HIٹHL|1/HT$H=ADNE~@I~A AtHھAtAd5fHھIٹHL|1AHT$AHDOE~EAwHH8HEH HH HH9ufDA:fHھHھ +f.@t't5t>t@tB-t#1HH3DøڸӸf.tt-t6t8t:1t1HHˊHDøڸӸfATIH5izUS€tmH-u1LHt`Hu H54zL€t)1MQLH5 z1[]A\fDHcHH[]A\f.HtwHHcH>DHnHSH,HyH9HHH=9HH=;yHָtqH=HָtQH=Hָt1H=Hf.1ff.fHӑ>Hff.ATUSHGYuLgHHKPHGv ǂG1HBM1HH?Hx8HSPHGDGH[]A\f苤L`HwfHCPH1LLAT1H5wXZDATAUSGHv LJG1HBDHcwHZxGDGH[]A\@EL(w11H5vDHHHjDLiH@HHHjDL)H@HHHjDLH@AWAVAUATUSHhdH%(HD$X1HHl$@HHnD|$HHN6HDDLL)T$ L$D$kHIiHLUT$IH5huRD$PLAVL$0Q1P1AUAWAT:HPHD$XdH3%(u7Hh[]A\A]A^A_Lق1ɺH5t*f.ATUHS7HHH9L%u@HPLuH5tHBPHrH1L@1dHC 1LtDH p$DΉH5@t$1-HXZH9tgDKCH1H5tMDȃP1HC Y^HELt1ɺ1H5sHH9u[L]1ɺH5s1A\Ls1ɺ1H5sof.AWAVAUATUSHXdH%(HD$H1HHII@LHk\DH-L sH5rL5sELsLE11Hf1LsIH5r1HLDhIuLKpH1H5r1AVL`s_HYHH_HH9ILI)HIHLLH(1PM1LC}H5qXZ+t Ls1ɺ51H5qDA$bDLLr1ɺ<IH5mq1[D11@LrH5Cq311ALrAH5qD11LrBH5p<$CL c1MELr11H5pL11DH5pHD$HdH3%(HX[]A\A]A^A_LII)IH@ILcq11*H5Bp2MDALq11>H5pHL p3LELq11H5ofDL}1ɺH5off.@ATUSHPdH%(HD$H1H[HI@LHgŅH߽Nc1L&qTIH5o1 <$VL /MELp11H5nHpL LDȺX11L1zH5nH1ɺZDLpH5nD+P1jXL?Z1ɺ\H5Yn1GHL$HdH3 %(uXHP[]A\@L{1ɺR1H5nDL{1ɺO1H5mATHE11UASHH0dH%(HD$(1HGPHH8D[pLC`t 4$1҃HCXAE1E1H҃HsPHH6WAQASL@H5.mRrUATARAPLxP1QsHQ1H`HD$(dH3%(uOH0[]A\1҃HCXL$‹|$DL$ AHDT$]HTff.fAWAVAUATUHHSHHdH%(H$1HD$@HD$HHD$PHD$XF\D$L$H{ @LdAŅ1HL$`AHAH8HCXDD$`%E E1L5mHHmLDLn11H5k1ҾH豜AŅ HCP1H5okLwHsH1L@>Y^HCP1ɺLmH5$kL1M1ɺLmH5j1M1ɺLnH5j1H}HH}HI踆H1ɺATI1LmH5j~AZHA[–AąO11LvH5VjE1CHHLpH9 HD$HYLl1ɺIHH5iLHH1IEXHt%LHHLml11H5hIHt%LHHLVl11H5hIEhHt%LHHLCl11H5}hmD$,D$ETHSXf HX H1LkH@H5hLHH1HSXD$$D$@Lu1ɺ1H5gH$dH3%(DH[]A\A]A^A_1ҾH蹘L$@AHLLpI~ `AŅ/ 11LLsH5Fg6E HAvHL R1L{iH5g1IFPAY1AZLniLH5f1M1ɺLXiH5f1H}HLGi1ɺIH5f1tH}H#L,i1ɺIH5Qf1?L1ɺ@%UfDH耒PE1E1HCXH$H%HT$H1HID$$AD$ HfVLi1ɺIHH5eLT$LHH1LT$1LyiH5neIH@LHH1MDl$HSXD$,D$IIDAH D$(EL$du  T$(H@guHEL fHLEHL"r1P@1H5dA]XE, MR IFXHHLi1ɺKIH5ed1SHD$PHlpHLi1ɺOIH5(d1HD$PHpvLi1ɺQIH5c1HD$PHpBL}i1ɺSIH5c1HD$PH1L,qVH@H5cLH8p@1yHD$`AY1L!qYH@H5ZcLHHpP1FAZA[L iHD$P1ɺ[H5.cH@LHX1HD$P1Lh]H5bH@LH`1HD$PH8DD$E|$_MIFX1ɺnLhH5bD1HH1LhrIH5ib1WD11LhsH5:b/EfAvTHLh1ɺzIH5b1CY,H@ILh1ɺAH5a1{`Lh1ɺIH5a1DKpAE Lh1ɺ1H5haXED$D9Kpt!Lh1ɺ1H50a CXtODKtEx!Lh1ɺ1H5aDKxLh11H5`H1ɺD$xH5`LL VLDȺ11LVH5`MPL (wAWAVAUATUH-WSHHxDdH%(HD$h1EA)HC`%H=t'H-`WH=tH=H-|JHHELd$ H{h@LGE|$ DHH  IE̋DDDDt$)DAt$D$DHL$LDT$ DL$JHAHL$LvZQt$VL$H5LQT$(1RSATAVAUDT$DARDL$HAQLAWPP1s`UиHpHD$hdH3%(u5Hx[]A\A]A^A_DLqY1ɺ=H5K艸¯fATUSH@H;HH;IċH)ƋHH;HŋHH1ɺ_ATLLYH5 KUP1H []A\ff.fATUHopSH_pH9t4L%k@LK8M1ɺgH5J1蟷HH9u[]A\fATUHSHH9t6L%kfDLK(M1ɺpH5YJ1GHH9u[]A\f.ATUH SH H9t6L%>kfDLKM1ɺyH5I1HH9u[]A\f.GHYHcH>L(T1H5I鄶@ALX1H5^INfDLQX1H54I$@LW1H5 I@LW1H5HԵ@A1LBXH5H驵fAWAVIAUATUSHHt$HHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81Ll$E1҅AE111AEIHD$,H$E}H>H8԰Aǃw>IcHDP@t HcÃD|,A=wSMcHFLLH$0D$H;HD$HD$@D$0HD$ 詥H;A,E111'A tT$T$H8Ǫt$T$)@A HH1>L$H8腪L$HI> L$H0PL$AyH-*UEAnH-U3H} H}uvH>H=zOH詫n:1ELOO1ɺH5DyD謨 DF$G$FPGPf.WHt$H|$ff.fSHHgǃt [LT1GH5TT°[ff.SHctժCt ǪC[D1HH5Cm¸tC[f.H5SHASHHHtDHT?L l1ɺiHC LH5uS1LK(HCaկH[LP1ɺc1H5AS误f.SHH(诡H[馡fDAWL>S1ɺAV1AUIATE1USHH52SHDHE1H-L5!SL5HHHt HLtiHLtS HH=84t9IE1HH@PHx;UL*5HtDMtIGIMt.fDH[H[MH[]A\A]A^A_IL$O1ɺ"H5&R<H1[]A\A]A^A_ff.HHH*f.UHHSHHHt\H%S?HHC yIHC(HtmLp}1ɺQH`HCH5Q1莭HH[]@LQ1DH5KQ\f.LMQ1JH5Q,H1BUHSHDO EuBH]HHtfDHHPHHuH]HHH[]@LQ11H5kQ褬fAVAUATUSHnH]HtHIIIfDMtH{(L跣uHCHtLLHLHH]Hu[]A\A]A^fDAWIAVIAUAATIUSHH7L LHkH]Ht7MtH{(L/uLLHLAŅt HH]HuLqLHD[]A\A]A^A_ff.@ATUSH_IHcHH HHHSLH_0HD7HHHHkLOHHbH5OHCHSHCHOHC(1C ѪH[]A\fLK1ɺK1H5fO1蝪L)O11ۺNH59OrLO1VH5OLHdnf.DUSHHDO HoEu.H}mHEHPHHH[] DLN1H5mPĩfATUSLfHt/HHH9t@HsI<$HH9u[]A\fDI<$[]A\S!AWAVIAUATUHSHHLnHtH~(H萠H"AąuYHL=cCڿI}HL9 L>CL95AHHD[]A\A]A^A_@HS8HE1LNH5LOHIH I%A к\P1聨_AX@IuHHLHH[]A\A]A^A_IEHHLc`HAąCa LXCSdMDžuDHL9CL NMHH5~NPLN1ƧY^H+H9uHmH9HuI}LuLHME1云H5NjDCduHL NVDHALMIH5M1 K` H谽LTLdIH5tM1ɦ@HArL>LjIH56M1苦fDATIUSHcHH8HL`HXHtoHEHt0 HHHHkLLHHH5LHCHHCH0HC(1C 躥H[]A\fLyF1ɺ>1H58L菥LK1H5LkH}HtH1sH[]A\L!K11ۺH5K"cDLQK1H5KfSDO H_EuH;[DLK1H5L謤H;[AWAVAUATUSHLvbdHf%fHH9E1AAfDHsI~x"IVD<AHE1H9uDEtlMd H諺LALIH5L1ģH1[]A\A]A^A_AFƒtm <t9f.H[]A\A]A^A_@EuHH(1LJ1ɺH5K@AN1LcJ1ɺH5hKAFAFafAWAVA(AUAATUSHH=TKH(4H HIHH/L @DAEH=K D @uIHHI;HHD$ 8/H@D$ Hut$ HLiwLJHD$Ht$ H}MaHEHL$ H0LcDHsar/LI10H5I蛡LK1LKJH5IsLL1B1ɺ1H5IGL1]H(H[]A\A]A^A_DD 1ɺH5AFL |@SDO HEuH[fDLF1=H5AG蜝H[鳏SHH $HdH%(H$14Ht8u*H$dH3%(HĠ[f.H$H1HHxHH޿u5CL!F1ɺM1H5qFǜC^USHH $HdH%(H$1HPHt8u&H$dH3 %(HĨ[]LC8H$H1HMAII AAA H xWHHyH觲LE1IH5lE1Kd1AfL`E1ɺ,1H59E菛ŒDCt"HB0bdHtf@u Hff.S8tq0HHjC HtLDHHH5|DHCHaHC(1ƚH[Ð11L%D1ɺ[H5GD蝚H[LY;1ɺc1H5Dof.SDO HEuH[ffDLH薩LbA+IH5B1诒Kd1[]A\@HL0HHFAT.L@AUI1H5A\XZHL@$IH5uA1!K` DS0HHtTLHHHTL@HCHpGH5AHC(1C 詑H[@L@1CH5@|f.SDO HEuH[vfDL@1)H53A,H[CUHSHHHnǧHS8cdHl$tH[]@HI1RLh@H5@謐XZKdH[]f.U0HSHtHHt\HELv@HkH=HHCHH51@HC(1C HH[]L?13H5?f.SDO HEuH{H[݁DL?1oH5@蔏fAUATUSHH(Hz8dH%(HD$1HFHD(D`D$ bdbt~1ARE!AHT$ HFŅuJSdL$ ЀtЀ CdH誥L&@_IH5?1Î'Ht$H;t?H;D$HL$dH3 %(H([]A\A]fH(L>"IH5}?1AKd1fDAA,D fDAA,@D f@AAD f.HxH(L?IH ?H5>P1腍XZ=蹄fAU0AATIUSHMHHHC HH?HCH4HC( HHD(1Ҿ#LQ1HkL=AH5=1UEɺ賌HH[]A\A]DLA=1{H5=|f.L9=1H5=LH1b~SDO HEuH[F~fDL=1?H5=H[~SHӃbdtaH 1?H1?H9tH;Yu FH9YtBH H9uKdH^8H5=IL[=1w1[Ð[SH莿Ht!HXHH=1?[LBH5=1[fH=0?S0܂HHtTRHHHtL<HCH<H5<HC(1C 艊H[@L51IH5c<\f.SDO HEuH[V|fDLd<1KH5< H[#|ATUSHH $H1dH%(H$1HHHHHH5HHAąuGHHAH$dH3%(DH[]A\H6L<IH5;1E1Md@Hȟ/L;IfH訟L;=IH5;1Md@?u#HDbdH8t"Hf.f.SHH$L\;&IH5:1=K` [ff.@U0HSHHHt\HEL;HkH_HHCHH5r:HC(1C 譇HH[]L21UH59:|f.SDO HEuH[vyfDL:1/H5:,H[CyJdJd@tauXBbuRH@uPtJdH蕝L:(IH5d:1讆1HJdS0|~HHtTBHCHHL2:HCH:H59HC(1C )H[@L919H59f.AUATUSHH $HhfLdH%(H$X1H\$PIHIHH-H߾)D$0HD$@mUL[1ɺ;1H59dI1ɺ<L|9H5_91@I}HD$0H\$0HD$Ht$HGD$P`HHMIHHL$HLHHL11L)9QH58ÄHD$RL 8L 9H58HLE11菄Lq1L8ISH5}81cHH$XdH3%(Hh[]A\A]fDHA4$71IL791ɿH58XZ1L%8LH57܃HEHH@PhnfL81BH57蜃wL|$8/E1H-pyHD$(L$HD$4HD$ HD$@HD$LMIfK>HLhLLH=St|LtHvnI|H57uR_L]uHt@HT$ HxHD$1H5MAluHL$uL)HQH@v}DLt$8IM9;MLd$(1IHI"LkZHmYH;l$L}AoAoOLsXLC4KDxLHCp|LCx1LC|H<$HH IHLL#IH5!1E1j@D$MMM9uP@1ɺH5R!1IL!Tj1H#%M6M9yI~8HH݀HH#uIAL$H5 i EH{ALy$IH5 1iID$0Ht$0HD$@HD$8H$Hx`HGP`HH{M1ɺ1L$#H5- ;iLLd$ADž,H$HH@`H@Ph1ML"H5h H}L"IfDLpBADžLADžtXAL"E1H5XfhH{wL"IL 1ɺ1H5hWIE1LH5g*L1ɺ1H5g_ATUSHH%IHI$H9t0HHPHJXtDHPHJXuvHH9uLtJH(1M$P1L"H5 gXZLy[]A\fDH11LDM$t41ɿ1L'"H5fL{a멐L!11ۺH5|fhDLI1ɺ1H5Q1]fCAUATUSHH $HdH%(H$1HIHHAILHHH*1lx7DLHHH$dH3%(u;H[]A\A]D1L!5H5e1\ff.AWI1L~!AVAUIATUSHPHdH%(HD$@1B(H|$(IHt$8H5HD$0P1eH{hHD$0D$HD$XHGZHP`HLp ILŅ I\$ I9twL=0fDHCH@0HtHLLЉŅ~HI9t>HCHLLP ŅuM1ɺ[H5R1cdHI9uID$LH@PhHL$8dH3 %(HH[]A\A]A^A_@M1ɺ`H51d`fDL1 11NH5cL) 11SH5cID$LH@PhMZATUSHH $H1dH%(H$1HHHpHxHHHILH_ LHHH1ix>aHHLH$dH3%(u\H[]A\Li11ۺH5bLy1ɺ1H51bYfDUSHHHHxt{HHEHHxÅHEHHx[uX8HiÅH[]ÐPLH5JH11aH[]f1L1ɺH5qzaH[]ÐLL1H57EaLt1ɺ1H51 apff.SHH?Ht[fH[WATUSHH $HHdH%(H$1HHHx uHHLHHHHH1(g&PHH;HAHH=@(9C(iDO1HG'Hr1H-HMu)L1ɺH5_f.H$dH3%(H[]A\Du1L1ɺvH5@N_HfHH1LH5 HLH1_XZ`L1ɺH5^@DNL1ɺ1H5^fHuhH{hDsNHqUHHw jPHSLhHkH5N1(^[AUIATIUHSHHHdH%(HD$1-P1҅Ict$0H|$NHGHHfH HH9uD4It$bRI|$LHھ PHtHT$dH3%(uuH [ÐCHUÅt7L1ɺ1H53ZDL1ɺ1H5 YyQff.fAUATUHSHH(H$L$L$t@)$)$)$)$)$)$)$)$dH%(HD$h1HfH*Y f/H>H ofHHtHHYf/wLd$ @HCL_1~FLl$fDLHLHH$PD$HD$HD$pD$ 0HD$S tH|$hdH3<%(u?H([]A\A]HfHH H*XH EiOfAUIATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IH-$LLHH$D$0HHD$HD$ HD$S tHT$dH3%(uH[]A\A]NAUIATIUSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hf$HLLH$D$0HHD$HD$ HD$S tHT$dH3%(uH[]A\A]MAUATUSHHT$HuH[]A\A]f.IILHH5LHbNH|$xPHtHuH{HHJPHuLD$HLLHS1ÅrL1ɺ1H5UQATIUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HfH$1HLHD$HD$ H$D$0HD$S tHT$dH3%(u H[]A\KfDH1HH5AVAUATUSHH $HHIIIdH%(H$1HAD3HH5L1ÅtrMDH 3ÅHH5L1\ÅH$dH3 %(H[]A\A]A^@Ly1ɺo1H5SDLO1ɺnH51eSL)1ɺr1H5c?S]f.L1ɺs1H53S-EJDUHAWI1AVIAULmATISHdH%(HE1NLHE @H]H5*LH1H56L1ÅBH58L1ÅLjÅLx\HHHH%H)HHH9tHH$H9uH|$LH_H5LH1SÅ1LÅH4MCH5LPHAPL~LHH=L1XZIHt :7L>HUH5FLH1ÅU'fDL 1ɺX1H5CQHMdH3 %(He[A\A]A^A_]L1ɺWH51PL1ɺZ1H5PDLq1ɺ]1H5PcfLI1ɺY1H5_P;f.H)HL:fH5)L1ÅL1ɺc1H5(PL1ɺd1H5OfL1ɺ^1H5Of.Li1ɺa1H5O[FDAWAVAUATUSHH8H|$HdH%(HD$(1t)HT$(dH3%(H8[]A\A]A^A_@HD$L#L9E1fDI|$AM$$MlLl$L9uI}H|$e?IHD$ HLl$Ld$ 1HgLLfL;L9fIO1H%LL8M?L91HBLLuL1ɺH5<NL5@L11H5ML1ɺ1H5MfD1HfLL脾H|$LH#1H5ŅtAL?>L91ɺH5pQM/@L`?L 11H5CMf.7fDL1ɺH5L@L 1H5 LLq1ɺ1H5 LeCff.fAWAVAUATUSHH $H8LnXdH%(H$(1HHAHUHH5!H1AąC0H} {0NC0L$ LC0|AąLH5*#H1-AąALHAąrHH Aą0HHHHtH5x H1AąX}`t$;cH5` HH1AąHEhHt HPH5M H1^AąUpH5C H1.AąL|1ɺ1H5 J$ALV11H5 lJH$(dH3 %(DH8[]A\A]A^A_L 1ɺ1H5C JDL1ɺ1H5 IDH}PW:II5)fDUtUxxFH5E H1Aąu.Lg1ɺ1H5 }I HHHD$H5 H߉1AąHFAąqHC0LHD$L9l$xHD$ AHD$S1DH5 HTtC0{0HNC0H5 C0AU 1#AE$AHk HHH1pHhAM(t&AH< HH1zIEHL$H5) HHP(1IHIEH@ H@HtHLЅC0PS0?1H5H2MmEL9l$IEH|$EgLuPHPX,LJ1ɺWH5bGL+1ɺ1H5eE1>GfL1ɺ1H53Gf.L1ɺ1H5Fnf.H5T H1/AąL}1ɺ1H5F"fDLQ1ɺ1H5gFfL)1ɺ1H5c?Ff.L1ɺ1H53Ff.L1ɺ\H5Ez@ALH5H`AąUHH5H1 Aą2L[1ɺ1H5qE@L11ɺYH5hIE@L 1ɺ1H5CEf.L1ɺ^H5D@HEH5NH1AąL1ɺ1H5D3C0PS0&H5H1AąAL)1ɺ1H5c?Df.L1ɺdH50D@L1ɺ_H5C@L1ɺ1H5CNL1ɺ 1H5C(H|$:LN1ɺgH5fCH|$L1ɺbH5R3CL1ɺnH5.CL1ɺkH5 BL1ɺ1H5BT9ff.AWAVAUATUSHH $HH $H8dH%(H$( 1IH5rHHC0HD$C0C0MIHL$L9PLd$ Im LHH{L蹶IHHA1LH5H6C0{0LNC0H5H߉C01HH3H=HLH?OH5pHH1+HKHu@I>臡Hu@I>HD$֡HT$IHt:Ht51H5!Hc"1LH5HGHH+3HH4<H1HHH9H1H5H9AH.HHH1d,HHtHBC0PS01H53H`MmL;l$C0PS0u H|$r1H5H!AfDC0MIHD$L9OC0@H|$XfM1LH5M)?L11H5,?E1H$( dH3 %(D~H8 []A\A]A^A_f1H52H/3H1H!HHD$LY1ɺED$LE1ɺH51[>DL$LD$L1ɺ@DL$L1ɺ!D$L1ɺ"@D$L1ɺ%L1(H5=E1@D$L1ɺ-;fD$Le1ɺ.fD$LE1ɺ8fD$L%1ɺ;fD$L1ɺ=fD$L1ɺ?fD$L1ɺA{fD$L1ɺI[D$L1ɺ3DD$Lw1ɺ4-D$L`1ɺMD$LI1ɺD3AVAUATUSHH $HLv`dH%(H$1IIHH~hLLH5hL1kÅ!U(H5oL1MÅHEHfHH8HNL1H5PjÅAZLLÅHLÅHHt :+HHH5L1ÅpHHH54L1oÅL1ɺ1H5:#fL1ɺ1H5:H$dH3 %(H[]A\A]A^fDLG1ɺH51]:HL1HnÅH5 L1Å;H5L1lÅrEPcHEXHtHPH5$L15ÅLH5L1ÅxLY1ɺ1H5o9f.HEHH@HAHII5L1ɺ1H58;f.L1ɺ1H58 f.Ly1ɺ1H58f.LI1ɺ1H5_8f.L1ɺ1H5S/8{f.H5L1ÅL1ɺ1H570L1ɺ1H57fLy1ɺ1H57f.LÅ}PvOH5LH1ÅeL1ɺ1H5K'7sL1ɺ1H5%7ML1ɺ1H56'L1ɺ1H56-ff.AWIAVIH=AUATUSHHT$dH%(H$1hIHsڨIFHIM1Ld$PHl$pL9Ll$L|$YfDI>LlIH@HLI~LH躪 H $H;\$tuA LL{$H1u<yLZ1ɺ1H5p5L91ɺ1H5s1M5YL|$EF8EIH5#L1ÅAF0LLA~0ANF0AF0ÅLÅ=LLÅ(LÅ>IIF0HHD$ >ÅL1H5L[AF0AF0wAF0ML9 I|$tIt$L5M$$L9uML9t,I|$uIt$LuM$$L9uAF0PAV0u H|$ k1H5LjLk1ɺ6H53LI1ɺ1H5_3nDIHT$LHAÅ L1ɺ1H5:3%@L1ɺ1H52I>Ht fII~Ht -IFH$dH3 %( H[]A\A]A^A_f.LY1ɺ1H5o2{f.L)1ɺH5`A2@L1ɺ1H5;2fL1ɺ1H51f.L1ɺH51L@L1ɺH51$@LY1ɺ1H5o1f.L)1ɺH5`A1@L@ÅIHHD$ªÅX1H5#LgAF0AF0AF0IHH9D$HD$@\$,Ld$HHD$L4$L|$8IHD$@IGLhImpI]pH9E1HE8uH@HxH"MtLt$@HmH9uMUI~H|$@ HH Ht$HD$HHVI1LؠHMupL9ttLl$0MIH\$fIE0uJu 1H#HL莠IEH@HHLHHH1f>1MmM9uLl$0Ht$1HHL8H\$pI} (HzH<$IIUHH<$1H5#H $HH5cA0y0HNA0A01WfIUXH<$A(HH5bIU`H<$A(HH5=IEhHt6HPHRHH<$H1H:H5IHtH<$1HH5 H $A0PQ0H<$1H5M}H M?L9|$WL4$\$,L|$8AF0PAV0u H|$ y1H5L(AF0PAV0H5ѧL1ÅAF8!}@L11ɺ1H5kG-}fL 1ɺ1H5C-Uf.L1ɺ!H5,l@1ML9\$,L4$1ɺyLH5,HLb1ɺ1H5x,LA1ɺ1H5{W,cfL1I\$,dH5NL4$&,L>@R1\$,LH5L4$+NL1ɺ+H5+<@L1I\$,XH5L4$+cfH|$ &\$,L4$1ɺ{L*I?HT$LHǐ>ÅL1ɺ1H57+L1ɺ2H5*jIHH9T$L1ɺ_1I\$,L4$H5*yLh1ɺ1H5~*\$,L4$1ɺL3L'1ɺh1I\$,L4$H5Q2*\$,L4$1ɺ|L`L1ɺH5)v\$,L4$1ɺL!H<$1H51c\$,L4$1ɺLsLg1ɺH5)\$,L4$1ɺL4H|$ 1AF0\$,L4$1ɺLv\$,L4$1ɺL[\$,L4$1ɺL@AF0 HHH5f.AWAVAUATIUHSHHhdH%(HD$X1HH5H1AƅYC0C0At$LE1L-'ADI$H @L4LhI|$HBG7HHHXI$HJT2HHHJXHHHHRHHD9LqH5MD1AƅLD1ɺ1H5~Z'5DC0At$LC0HBHxHHt$@Ht$諲H{Ht$赛HHiAD$LLpHߍpI$D9H5<JD0MDŋH1"AƅzAt$LAD9UC0PS0u H{0/H5?H1Aƅ\A;I|$@ELPU1H5IE1"&XZH\$XdH3%(DTHh[]A\A]A^A_f.AL11zH5%f.LoJHD9HPHH5MD1AƅLU1ɺ1H5k%FfDL)1ɺH5`A%L 1ɺ1H5DE1%L1ɺ|1H5$f.H nHPHHD9H5MID1*AƅLx1ɺ1H5$ifLL$L1H5{W$I|$>EL9PUL1ɺ1H50 $L1ɺ1H5 #1E1L H5#UfHSHHXdH%(HD$H1He)D$HD$ HHD$(C)D$0)$HT$D$8uJHHHuHL$HdH3 %(uHX[]ÐH|$VGAUfIATIUHSHHXdH%(HD$H1G4)D$)$@H)D$0HD$ HHD$(Ct$u t$HD$HtHHHLtfD$HT$I$HtT$HL$HdH3 %(uIHX[]A\A]ùL8H5-"1f.H|$1-ff.fU1H5:HSHdH%(HD$1HH$Ht5H<$HHtTH<$HL$dH3 %(HuqH[]ÐLL21۹UH5iE!LL*1ZH59!H<$,|BfAWAVMAUATUSHH|$H4$w^taL1H5Y Ln1ɺH5:1E1 HD[]A\A]A^A_H=ILd$1H9LL HHLtXHI!9kuMH HtEu HLLҐADž&H HeLL1谐ADž1HHSHuH8LL1肐ADžAML1ɺ1H5+wfH9=@ILd$H81LLH2= L1ɺL1ɺ1H5vL1ɺ1H5PL1ɺ1H5d*ff.AWAVAUAATUSHH(H|$t$ ?t_%L11H5D1L 1ɺH5#1H([]A\A]A^A_L5=HD$fD|$ IFHtBM1El$tL{HLEHH@M$ID$Huʃ|$ L{H=wLHL$H[H_1LH5#H(1[]A\A]A^A_fL{ H=LuAHtZA I$H T$|$ mH5L PQHA7L{1MLbH5k1CHD$HT$H H([]A\A]A^A_L5l=,L5 = ff.AWAVAUIHATUSH(Ht$+HHD$HHzH=HD$HH+HE1HtL`E1AFIH@LH516HAYAZL9"It$hJ<6H9`ID$pHHLH1LHIHt#LH)J<6H9RHHL)HHHĘH1ɺbPL1LH5kH AT$|AD$xHHHDH;LIT$HtJH[]A\A]A^@HAULUI51H5+X1Z[]A\A]A^ÐHC`1Ҿ,Hx<,HcHILC11*H5y@HH聗H1ɺsPL1H5L4ID$hY^HIL$`IT$pHt H4H9I9L)H9HHIDHrfAD$xvqfHȖHLGI1H5[1]A\A]A^fDLH聖H1PL1LfH54_AX@H@yLIsHBLgIKHHIHC`HxY+HŋHHHtHC`Hx-+ATLWIUHDSHHPHt:!H{haH[XUH8SHYBHHt1oEoMHoU P HE0HC0HH[]DL1H5 f.AWAVIAUMATIUSHHH>L:I$H AWI1H5Lq\ I4$I>HA_X襸L{ϦLD$J9D$H{(HC(t@HH8uH5A%r0N*>I3WH LVM2 x[H3CH M<${uoL9{u)AE!AmH[]A\A]A^A_I>X#AWLK1P1LH5p AEZY fDI>#AWDKPH51ɺL10 ^AM@M<$_L9{RvfDI$I>HT$"HT$D 1LfH5:RP1 AZAMA[fDI>x"H1ɺAWI1LOH5 AM {AXM<$AYfI>I$$"HLSI1H58 []1AMH[]A\A]A^A_foATIUHHrSHz(HBBHjtHB(DHH8uϦOHHLLHٺH苽Lt_[]A\DK!LIH51d [1]A\ff.fUfSH8dH%(HD$(1)$)D$D$ wAooWAHHh 1) $)T$HL$(dH3 %(uIH8[]fHG`H@Hh8 ALHUH5P1 X1Zff.H2fAVAUATUSHH $HH $H HjH]dH%(H$ 1IH߾/-HH)H=L$HPHL~I$Ll$HL$ LLLGQÅ|$ H5IIH;H 01AUM$LH5Hu_LAXLÅU|$ t8HÉxHuL\ÅHu MLCH5[1HuL0Y^+L1%H5H$ dH3 %(H []A\A]A^Ly11ۺH5bL)1ɺA1H5?1A.L$fD$@1MLR3H5AL!th8|$MH HfHDHLPHOH5P1R5H @H-SH8IK|$HMHEHPHbLFPH5z1R*H |$ A<$|$MLHDH,PHPS@LML-L%aLLA9H5IEHPHP1R:tH L!;ILML`<A9MDHPHPATH5y11H [8FMLyP1H51uXZDAWfIAVAUATUHSHHHzpdH%(H$1HBh)D$@)D$PD$`)D$p)$Ƅ$HD$5eHLKpHtoxh)|$poxx)$o oSHD$pH|$pLd$@HK@HD)L$@HL)T$XIw0LjjPH HHXHLHHHD$(=H{ o+osA),$A)t$L|$E1H\$ LH|$D HҵIHtyLxMoIGI?H I HD$AUL t$I1H5i XLZIOIWE1I7AH AH\$ HL|$HBAŅHH\AŅaHT$0H5UHH\$8L|$0AŅhHHA蕋DAHDEHDH{@Ht$(AŅtA}@o[ oc0A)$A)d$wfDAvDLKpAo)\$pAoa)$L1ɺ1H5H$dH3 %(DHĨ[]A\A]A^A_L91ɺ}1H5E1Lf.L 1ɺ1H5|{f.L١1ɺ1H5LKf.1ɺALH5fLy1ɺ1H5DAWfAVAUIATIULSHLvh$DL$dH%(H$1)D$0)D$@D$PxA} D$AoM AoU0)L$0)T$@Ht$0ٺ LIMH Ht$ MH I HD$II H HD$IHD$( HtL=u<$H H|$t L+|$H M9LfHALP H5y1YE1^H$dH3%(DtHĘ[]A\A]A^A_f $MA ȅH "M9[$I9s $LL)MI)M9LML)LH $茅HL AWHL$IH51Q1U;H AHD$vD$H9HAI}@LLFD$L[D$?IE`HD$L`hIEhHxa5D$HIIEh8D$Hx;5D$HIT$IGfLAG t$IWIU@LpHHhH@H@0@ D$ҶI}hALAomAouHT$` Ƅ$)l$`)t$p諴D$fAo]Aoe)\$0)d$@Il$8LAٹL}UPfAH $HIHH HDLEHt$  LɮHt H@HH|$MH HL$ AtIHL$ H9rHct$L1HHH)HLELT$I4.MH1H|$(IH HHtHI>L9I4.I94$LL)H|$H?H9cH)1I4.HHHt HH)I4.L9$H H|$IIID$EL$%HAL7PH531AXAYD$@H|$HtL1HHtHI9{I)M9MCHChfHt$ 1ɺ LHH@HL@L@H MHD$HIH L9vK$LL)LfM *I)KL9SHq1LHt$H#$I4.}@LxH MIz@L踀ATLAVI H51m_E1AXMfH AfDrHIL PH5n1AYAZH La1H59L1ɺ 1H5E1L7H5LLf.AWAVIAUIATUSHHHHnhdH%(HD$81~ D$0oF oN0)D$)L$ ILd$HAdž LbHtSHPHtJHrHHt$ӬLAstoLD$ELLI tJHtHiH\$8dH3%(HH[]A\A]A^A_fLh~L< IH51!1Doo^)T$)\$ LXLH HPHtH@Ht H@H HI):fDAWAVAUATIUHSHH8LnhdH%(HD$(1~ D$ ZoF oN0)$)L$M9l$tH1I LL豨IHtI|$ L蕨Ht_Hs@HSH1EwIH9HH螴ŅLLIŅ@L LE1HtH@HtLhI It$HݍHHuqA$tvHHILDHL$(dH3 %(H8[]A\A]A^A_oo^)$)\$uA$tH+1L)HH9xH1{L2IH5޻1:f.ID$LHx/HI|$A LHޫfL1ɺ1H5lf.Lɔ1ɺ1H5<f.I<$gHHzHLUI1H51XZGLP1ɺ1H5úf!ff.vSHH@HtfH{[<&ff.HSH@Hx t [L11ɺbH5[fUSH>tH[]HFPHHHph}ŅuHCPHLH5LsH1AXZff.ftMATUSHHv@Ht2HH1uIHH<vgLOt[]A\Ðf.H{@wLp1ɺIH51Ef.H{@7L1ɺIH51SE`HXxL|IH5p114f.AWAVAUATUHSHfHHbHxDeh(HHCHA H{HC(IHGLuH>L{ID$MM.H5#LxHHtLIDH92L}$HHaLL'HEHIvHL&HEH;IvHL&HEHIl$E111AD$ LHHC@M(tLmHm&bHC@HyAucHH[]A\A]A^A_ÐLLHp#HHHD$MH H1~LL$LM)HLfHlHHvL1ɺsH52RDLUH5H{1!Ll11 H5ߵDLA1ɺ 1H5WfL1ɺ]1H5/|f.H5*@MLyiH5H8fD1fL1ɺ.1H5 f.HoM1ULBH5ѴyXZfL91ɺ1H5QHL1!L1FH5} FML&11)H5Gf.L1ɺ?H5kL1ɺ;H5GLa1ɺ61H5Գw!fHGH@HHtHf.SHGHXHHtcH;RHHC[ÐGDGƒE‰GAUIATIUSHHjdH%(HD$1HGD$H@HxH1HULD$HHHHC(LHC0C8aH{(FHuH}HHC@HCHCPŅHL$dH3 %(H[]A\A]H}L1ɺIH5*1FfDL11H5uDIEHH@HxL1H5X3ff.UH@SHHZdH%(H$1HHHHHCHD$ H}(HsH;Ht'H$dH3 %(u7H[]Lw1ɺPH51fDAVAAUMATIUHSHGHxHHtFHUMDHHtH[]A\A]A^fID$H1Hx]L1H5AAMff.fAWAVAUIATUSH8HiHH4$dH%(HD$(1HD$$H9t.IHPIEHuH;r@uCHPH9r@t6HH9uH|$(dH3<%(H8[]A\A]A^A_@AU AMDLD$$HI?HHHC(HHD$H{(HE(Ht$HM U0Et HK@HCHSP"HK(HC0S8HC@HCHCPL薜H|$zL肜H3LEH}H,HDLD$HT$H}(HT$L-H At$(LIEERLD$MDӺYAPLP1VH5WQ ARM$LT$@H0H5H}(LHK@HS0LtLDHC(sHH5Q RbP1ASLT$8ARM$H0L|H|$`HuH}H@ŅEH$@LDH{0;HC(HC0C8HC@HCHCPL1ɺ1H5&1qIHH@HxL1iH55HLHJI9t'L@LM9P@u&fDL@M9P@tHL9uHGHHA(HHE1HH?ff.@HHwHHHE1HHHwHHHAHAWAVIAUATIUSHHxHjLoHdH%(H$h1D$THEH}HD$XHD$$HH$HH9t'HPH}H;z@uMDHPH9z@t>HH9uH$hdH3 %( Hx[]A\A]A^A_AT$ AL$DLD$THI~OIHIEHvHD$XAEEu D$PAED$8HID$ LLHL$H5ͪHTRPC(Q t$ P1TID$ H0H-HH-I9I|$( AID$(It$0M|$ HHD$H Ht$(HL$HD$ AHD$(HD$D$?O.C(LM9|HLm MzL&Lu( H5t$(t$8t$(t$8P1tC(H(LjL( AVH5AWAUP19H0S(LH|$ L;l$mM9dLl$L KD.H5<PDx1AVAAURkH E LL׹D)H5RN<2KD=T$PH)кPC(P1sD$pH DT$L9}H}Ht$It$ 蚒C(j AWLH5~AULP1H H}LHL$XLݓaH}謓D$8E0M|$ D$?AHD$ HD$(HD$HD$M9MBL;|$HLt$0ID$ H-PAVt$ RNH51VH0H1"C0HLt$`HLBK0YLHLLHL$PHT$XHIH<H|$XH.D$PI}Eu AEIHH{HSHsH;LLHCHh~H{HHt$XDϦD$8AEfDPC(LAVLH5t$P12H HL9HHD$?HL$HD$ L+|$K(LI/HIŁtH)HL,RxLAUH5P1Q M|$ H IL9C(HLLh AUPH51AKM|$ H mLLLT$HHL)L)HL=Ht$HH5\HL$8Q RAVAUP1C(H(Lm Lu( Lt$(LAH5t$8t$(t$8P1C(H(Lt$8LS AVH5Ȥt$XAUP1bH0S(L|$?LT$HH|$ HD$Ht$H9D$@H9I9zHD$Ht$0M)HMLHIHHD$(HDPHL$ ADT$PKD=VH5Q P1AWAURtH@DT$E LD)L"AHD$0H5D\$(MHD$ LT$ LASPL)L\$ PC(P1)L\$0D$pH LT$ MI9L9L9rrHLPC(L(ARAWt$ PaHL1LL1}H5-|$?M9L;|$L;l$CL)D$?HHD$ HHL$$D$PM1E1HD$0HD$L{1ɺ1H5CL{1ɺa1H5iHLXehPQ 6D$PLT$0I9H}Ht$LT$It$ 辋LT$C(L LH5ARLT$AWAUP1/H H}LHL$XLLT$vM HC( LARL|$(H5.LLT$AWP1H H}LHL$XLT$L+t$0LL{L $LH5ʠmPD$0LLCH5PC(ARAWt$ P1+$H0LT$0I9 LL1H5BHLPC(L#ARH5AWt$ P1$H0nL $1LէH5ɟlfAWAVIAUMATEUHSH8HH4$T$pLD$HHL$1dH%(HD$(1D$HHLx(HP(Et%H@HHtHK@H9tL{@LEHfDHC0E1LEHH AHK L 1I9v <))<HL$ HEQHL$ QAOQHH5>V1QLWLPD$HT$H H@H}HHtqM LPH5{1t$AwAQLMH Eu}HT$(dH3%(H?H8[]A\A]A^A_AEM L8PH51t$AwAQLMH HK` vL1.H PLL$1L}H5@ZY4fH}HH5oPLL$1L^_fM1ɺPL H5%1t$AwAQLMH f.HHHHHP@ LMAPHff.AWAVAUATIHULLE1SHLIHC LkLP^_IHu HtMtHL[]A\A]A^A_Im1E1HH(VC HAIAH1AUILo1H5XHZM1L|IH5ț1iMt,s<LKE111HLB3DHLp1ɺIH5k1 f.AWAVAUATUSHLl$PHHIHMMMtHB H-HH-H IEHE(HH}0U8HF0L$ V8Hu L8AT$TI|$X)I9GLL$ IFHu(1I<$DE0AT@HƃWHI65>A)LSLH ÅI<$MEÅI>M<$Le0H](I^H LSAWI*ATH51SH Mt1HE HM0H-HH-HH)H H9HBIEH[]A\A]A^A_I>Hm(InH1ɺUILB1H5|XZI>I^H H5OSIL11AL$dY^eI>L1ɺIH51Lɬ11ۺH5ϘrDI>Hm(InH1ɺ"IUL ff.fAUATUHpSH(dH%(HD$1HHHhHv>HCHHC8H~HC@HHCHCXͩXHoH Xx>L-w>HChHLc LhLJILLOIH7WHC0HbHhHSHHH=͙HCPHZHCHHH$HD$HD$HUH{PHALK81ɺU L|H5;1HL$dH3 %(H1H([]A\A]f.LE H5H{0HP(H1L11$ H5LkL3 H5vH143L@ H5>]Lo1ɺK H58@Lo1ɺQ H5ff.@UH1SHHrR dH%(HD$1H`LD$D$H^Hte@8HHHH@(H@0H@@H@H@PÅt[HL$dH3 %(uxH[]DH1Li IH51DHPLx IH5Ȕ1ivf.DHG?HTBHEB+BHfDAWMAVAAUEATIUHSH5BH|$u11-eHHHHH LID$X;H5]P1AUATHEMjD$pLDHHPH$@TPt$xD$xPUlH0AŅ6D$`HCBH-huJ$LD$(AHL$8dH3 %(DHH[]A\A]A^A_f.HD$0H@HD$0HuHD$0H@HD$0HtAWMMAVSPHL$@HT$8Ht$0H|$(H u1ɺD$L4cH5 XDL$NfDML6H5ݡ#E1VfDAW1LAVAUATULSHH(dH %(HL$1HD$`HD$HD$L0LhLCHH5LIRgtHT$H5LzeADž'H50AL ghLl$MtuHIH$Ht$L`>-{HCHb1HHEHIT$HxHBh%HpL9HD$Hu_rf.HpHBHK1HHHteHLH tSHD$H@HD$H8tHD?AVLLԣP1H5FXZE1MHL$dH3 %(DFH([]A\A]A^A_f.HT$H5?L|dADžHD$8Ll$Mg@HH{>AVLڢPLL$(H5?1胿H LHE1<@A-DH!>AVLLaPbH5ߞ1#AXAYf.H=AVLLP[H51E1ؾ^_HL7@H11H@HHHZ=AVLPLL$(HD$HLLHAVH=AVLLPjH<AVLLP{ H<AVLLPoff.AUATUSHt?IIH@uAHsL}LLHOŅtYH[HuH[]A\A]fD1L?1H52H[]A\A]D1L]1ɺH5H[]A\A]fAWAVIHAUMATIUSHHH$H$HD$dH%(HD$81HD$(HHLHADžHuLaHCHH<H LiwIH515HmH(Ht$0H6ADžKHD$0H5s H5HD$0HCXH5}HaADž4H5HuaL|$H5AHL_tHt$LHHaLH5m@Hc_C`LH5HB_tWHH LPLL$ 1H5ҚY^Ht$L4nHChHHSpH5<H] AXCpHT$H5LAHN_tHT$HLADžCHsHH|$Hz/ADžHT$(HtHt$ HgADž-H%|ADžH{HH5.JHIXHpLIH51#fLZ1ɺr1H5ϹHL$8dH3 %(DHH[]A\A]A^A_fHT$(H5{H\ADžHT$ H5H]]ADžHLIH513_fD1ɺuE1LYH52LY1ɺo1H5E1ܸCp]Cp; LǞIH5@1脸HkX(IXHA9zHsHH=sH LIH5ϗ1HkX7I`2HE1L{IH51ηfHHLIH5M1葷@H|$C`HH1PLL$ 1LaH5@C`_AXLW1ɺ1H5ɖ;f.HLdIH51Ѷ@LW1ɺ1H5a觶fH(LlIH5-1q@Cp@HLIH51)U1ɺE1LVH5.HE1HLbPLL$ 1H5~ĵXZUHH5SHH?dVHH@ Ht8t=L 11L7H5PH[]HpH=ÀۅuH}H5PVUHH@ HtuHxu 17L LIH5r轴H[]@L L"1۹7H5?腴07L LH5 WfUHHH54TSHdH%(HD$1HXt1H4$Hu@ÅtOHL$dH3 %(u^H[]ÐL1wH5ʳL1|H5V蜳ժDAWHAVAUMATUSHHHH4$(L$L$dH%(HD$81HHHIHEHvI4$LH'ADžMd$MLLADžAIHIFpHAoEhILAFxAoMxAADžH5}L%Xt!IH5cLUADž`L|$ H5$eLL)VLH5!RLVLH56LUIH5BzLGUADžIH55LTADžHT$0H55LHD$(HD$0THT$(H55LTL|$0MH|$(ML*I *HT$H57LUtHT$LHdADžALHAdžIdžAH$IF`rJADžAAHLAAaI+LqQ1ɺ1H5AE1脰HL$8dH3 %(DpHH[]A\A]A^A_fDL!Q1ɺ1H57DLі1H5Ə f.1E1LؐH5ٯP@L1H5f謯#1ɺE1LZPH53~fHT$(HLE1w6L IH510L1H5{Ht$ HIFPHL:H5q輮Ht$ HIFHHeLH5)t>Ht$ HKIFXHQLH5,*LA1H5sL1H5̭CLN1ɺ*1H5Y蟭LHT$4HT$ H5,ILڕ1RAW^HD$@IHD$8IY^ILP4HL(SI1H5XZy8AWIAVAUATUSHxH$H$H|$Ht$(H$LD$HuHD$ dH%(HD$h1V!H}LuMpHx LH!ŅHCPLE1Lt$0o@hoHxHD$HHD$K#HSXt AEHmHxH} uLeD$DM$HT$H5OLNHT$LH5@1LNHT$PH5LNuD$PHT$TH5)L`NuD$THHT$`LH5VHD$`TOHt$`L?IHH{XHH|$LRhHLLHD$8YLT$8IB H@ HtHt$DLLT$8D$LAzt$TT$DHE1LjjjjVHPRjjD$$fHPHHH@H@ H@(HtHHL$8HT$ LHL$8HT$XH50LHL$8NHL$8HHH9tQ 9P v9P wHH9uA$HHL$8"HL$8HAHSXH@ĀtHH HSXt΀HSXtHH HSX t HHSXqALHLԒIH5 1QHL$hdH3 %(VHx[]A\A]A^A_@HsHLMLH5_AXLI1ɺ71H5רLI1ɺ1H5i1譨WLt$0HT$`H5LWKD;l$`1HzH HL$ILctHHCXqHsHLMH5LȑY^@L1H5n货LKHJ1LH5:耧HLԑIH51IL@L\H5ӆ!fL11H5DL1=H5v輦HSxH5D6LmIŅsH5L4L<HD$HP StKxHt$(H|$/HL91ɺIH51$HCtLMLE11H5LKHLȐDH5t躥DL1H5F茥HT$XHLHL$8/HCPHLH5LsH1)XZ*fH訿LDIH51fDLE1ɺRH5~ɤ@)L׉LT$8] L$Lt$TT$DLT$8HHHL$8PHL$8fDL9E1ɺ1H5 ORf.HStH5LFStDƀH'H8HSXefDLD1ɺH5~ɣ@LD1ɺH5V衣@LaD1ɺXH5.y@L1H5LOHϽL1ɺIH5ׂ1H@H5qHxHHSXHlH@HSX\ AWAVAUATUSHXH)Ht$HT$dH%(HD$H1H8IHmH#H} uHULH=GHHVHC;HD$IH]IHHmHT$0H5>HFtHt$0LHCHGL|$(H59'HLEtHt$(H|$HHXLH5'HEH{hHRHS(H5A'HWDaHt$@H HT$8H5HAEYHD$@H5 HC`HH5&HCHH5HCHH5qHCLH5%HDLH5*HDtTH 1LL$8LH5-xY^Ht$(LSHCXHHLH5ցHCu ǃLjL LLAVATUjSHL$8HT$@Ht$HtH0wHT$ H5r&HtDtHT$ H|$H UjL LkLAVATUjSHL$8HT$@Ht$HH04jL ~L%LAVATUjSHL$8HT$@Ht$HH0'jL SLLAVATUjSHL$8HT$@Ht$HH0jL LLAVATUjSHL$8HT$@Ht$HRH0 H+LLHD$HtVHHMIHt$(H|$yHHfLLH1HL$HdH3 %(H8HX[]A\A]A^A_H5HD$@sLLފH5}Ht$8H|$HHLH5d}话:f.LLB1mH5/}uL11ۺ)H5}JyLL5H5|L=1ɺ.1H5|L*17H5|͜hH|$(.CPH1ɺLL$8LH5:|腜CP_AXLψ1@H5 |RLLLH5{LLH5{yLLH5z{KHL%LL$@IH5?{芛AYAZLL H5{XLL;H5z*LLMH5zLLgH5zΚYLLqH5Zz蠚+LLH5,zrLL-H5yDHLLL$8H5yXZBfAWHAVAUMATUHSH(dH%(HD$1Ld$`fHHHMHCH`H3IHGH{LoPHp0I4$L{HPIGHHM|$MHCLHx AHCEEHPPH56LoBhoJxHT$H<tHt$LcHID$HHH5ZLz>t)HT$H5ZL<HCHT$HPXH5\L>>t)HT$H5\L;HCHT$HP`I^ILA8fDL1H5wHHE1^HL$dH3 %(D_H([]A\A]A^A_HLHH1A!LkH5bw譗XZf1E1LH53wyf@L1H5wL+L 81ɺH5v!@LL$L-H5v@LL$L5H5{vL71ɺ(H5Rv蝖|ӍAWAVIAUATUHSHH5vHHdH%(HD$81Ll$HGH;LL`6:~Ht$L!HE8HHHuH[HH{ uH3LHEHL{H|$LÅ!foD$foL$ Hu0LEMÅLH5Lx9tHt$LgHE@HLH5LH9tHt$L7HEHHHUPH5L7ÅjI~L LjLv11jAWUj_H0ugLv1ɺLH5}tȔFfDH5Ht$vLM01LAH5:t耔HL$8dH3 %(<HH[]A\A]A^A_LMF1LH5s3뱐L11ۺ&H5s LM81LyH5sؓSL41ɺ+1H5is1譓(Li41ɺ 1H59sLC41ɺB1H5sYL41ɺ>1H5r3ifAW(HAVMAUIATUSHdH%(HD$1H\$PHLImHID$HH[HHHTH5sH=8IH5[EHL`6@LH5X2HF6nLH5H,6u`I~hL HL$dH3 %(H[]A\A]A^A_@1L21ɺDH5qߑ1H4$LHEXHuL`H5Vq衑d@L9x1ɺNH5.qy@HH5brH4LKx1ɺRH5p3fDH4$L HEHHLVH5pH4$LHEPHyL[H5Zp襐R1LqIH56p|1N谇AWAVMAUIATIHUSHHj6IAD$LH?;HHCH[(tcpHSLHJH苐sHCHXAD$LH9;HCHHsLfHuID$HsHxPH5HSMLHJHnsD$ L+01ɺMLlH5n1!E1HD[]A\A]A^A_@ML19rA@MLtf.MLsMLSD$ LE/1ɺ H5n1[DL$ 3LKHnLH5mMLDH1AWXE1Zff.HE6>@HHHHWHHPHff.f.HGHNH9uHHHH@H HHBHSH^ HLHLH[Lff.HLVM2 001HfAWAVAUATUSHdH%(H$1HLVM2 001H^HFHo HHWHHC W@HooH$HHD$0K5HL$E1WLH5HH$HC(H$UH$LHH5HHH@H$UL$HI$ID$ID$AD$H$XWLH5HAD$ID$H$UH$HML$HH@H$MuE1I|$ AAHC(H*1H{0)ω)HcHHHO(H0II L|$L-E1E11Ll$MM1HD$ Ll$(Ll$UE3H~HԣHD$@1H$H2AHD$8H$H$H$HLT$xMd$ L$tt$pI LD$hL\$`T$XLL$PUHHD$HUH&AUL$ART$hRt$(L$APL~RL$ASt$`t$H$QAWt$xQ $$$$VSH}$VH5}$ $8ATj$XL$I AQI1jS$($虉HAH$dH3 %(H[]A\A]A^A_f.H{PHKHII 1HcHHLB(HR0MI H I L-gL|IH|HT$H H L=|H|$H=|HL$ H %HL$(H|$Hs0H HD$@H Ht$8EHS|H$HHщH$H$H9|H$fDL-(E11Ll$MBL=E111HD$ MMHD$L|$(L|$L|$?fDHLT$hL$`LD$XL\$PT$HRHHRHvAULT$pH5{IHART$XRt$(LD$xAPL0|RL$HWASt$`t$H$QAWt$xQ $PH {$jPH{$jP1RjjRjjRS$ HuDL'1ɺlH5zنƄ$?@HLT$XL$PLD$HL\$@T$8QHHQHVAULT$`H5mzI1ART$HRt$(LD$hAPL{RL\$pH?ASt$`t$H$QAWt$xQ $RjjRjjRRjjRjjRS$ HH,QH贜LXzIH5y1ͅ1C}HLVM2 001H9FAWAAVIAUIATIUSHHHnHEHD$1҃{<MHL1ڛHHH@Hz(H$HC(H߉>H':H$+HK HMt$ILY^AFdAt>Lx1ɺ1H5xA跄H}56fH}[<$QH1SILy1H5WxhA $XZD$HD[]A\A]A^A_AH}LmH1ɺQAUI1L:yH5w HEHC(AYA $AZE1H}H]裚HL#ySI ^H5w1跃_ANdAAXG@AWAVAUATIUSHDiH|$H$HILAoEAoMdH%(H$1HFƄ$HD$0HD$)$)$AQL Q8jAQBH HuIu HHM}(NHZBHBHzBIu(HtIWHIII7HuI1Ll$(E1H$fIHtHIOME1LHIHSuHD$(IH$@<HufDEoEtPA]DHMonMAwHMIwHt"fIUHIpHIuHuMLH\$0虘 LvIH5u1貁1HHH{h\HD$$HLH|$HD$$DŽ$HD$AŅE1E1$'H<$&LK H5uILqu11HHH{hHL$H4$HH|$D$$DŽ$4L脗Lw1ɺqIH5t1蠀LXH5vt1L[Ir1tH$HD$$HHC@ffDH$dH3%(DH[]A\A]A^A_@Lt$(AF<nfDH<$]HD$$E1H\$0E1HD$L蘖HELruP H5s1_EoAXcLXLv1ɺ?IH5es1tL,L]Z1ɺ@IH59s1HLD$$AF@LHA7H<$EAEE!AEf$uH|$HHv*dL薕Hf1PD$1LuH5r~XZfDAEDLY1ɺ1H5^rE1l~LA LcrIH5r1+~H|$HH)AŅuRLgL$豔Ls1ɺ(IH5q1}D$$D$$LAoH1ɺ4PD$1H5rqLs}Y^-H<$L$Ls1ɺYIH5(q17}D$$D$$H $HA@H*ГL!s1ɺ+IH5p1|D$$D$$藓Ls1ɺ\IH5p1|D$$D$$wsff.ATIUHSHHt2 谰HHt`LfHHn([]A\fD lLsHHu1H5p|1fDLsDATIUSHH+H9u 'HH%HHmHEI9u[]A\ff.AWAVMAUMATUHSHHLhHIHLLT$耯LT$HI?8LbH^IOfID$IL$H(LpLhH@@ H@0HAD$ H9t HHH;)uT@HpH9.tGHH9ut$PL;4LHpH|$XtHT$XL"H[]A\A]A^A_@AD$ DHjLrIHtf8HD$jHLKH5m zLL$Ll1lLq 1H5myH1[]A\A]A^A_ùL?KH5my1fATIUSHH+H9u 0HH{kHHHqkHEI9u[]A\UHSH$qHHtH!>HkHHH[]@Lp1H5lxf.jSHpHHtDHM!>L 1ɺ(HC L>HH5p1LK(HC`exH[L)1ɺ"1H5dp?xf.S=~c= H7tBuXbHH‰޿cHH'CHHtj[@ HsBzt`HuLo1ɺH5{}w1sH@A1#LoH5z9w1[DLzH5zw1[f.USHHG`t?kXgC`tnn{TeHCTH[]fDkL/oAIH5z1vC`kXgC`uH+LoHIH5y1GvH1[]fDlHߋ(HO1UILy1H5yvXZ/fUSHH`kt H[]DHH[]lAWAVAUATUSHdH%(H$1HHGaVkX HD$E1L53yHD$ĀOA@L-oDDH17iADžku AĀ6HS8H1ɿPLnH5xHIUH I%A кP1tH HHH$HHHhC`3A@M<DHT$ƿ/fHC8x H9D$8HHIH %LnH5w 1R#P1tYD^bE@A@L-wDHS8HLmH5^wHIH I%A кP1s_1AXH$dH3 %(Hĸ[]A\A]A^A_fDDcTH$LhlATI1UH5v:sAY1AZfLkIH5v1sc`r1JfH蘉L4lIH5Kv1r1 f.K`DD{TiAătHH=H1ɺ7AWI1LMvATH5uAUOrDcXH 10LuH5urD`uCT1ch8e2I1PHYLdHPH5^u1qXZiAWAVAUATUSHH $HHt$PHHT$XL$HLD$hH|$8dH%(H$1H$HH$!H$HHD$0 HL@kAH5t1qD$LD$dD$`DHICE1H8>_HD$XL0M.LL9%I~G`%G`L|$XgIF1҃ApXHCH8^HH<$HLJIUM9I}G`%G`MIuuI~IVL.tH5sHR8PHIH I%A кP1oAYHAZ@IFIULH` M9tI}G`%G`_DE1LsH5!soL$IMHD$L;<$HD$xHD$ DIL}sIH5r1(oID$`D$LO` H|$xHtaL$HuIGpXH9CH8IL0H|$0LLd$I$ML;$$HD$IGLD$ 11HD$xpXHشCH8] HD$xH$H|$HpHHr`IH_8oXHL_hHIHH UH5q 1RSmIoDŽ$H HD$Pe`Ht1HHH|$8mLd$@Ll$E11HD$(HD$HLABELONEI9EVEMeI9H*S1H5pATILh1(CmY^HIHuH|$Ld$@Ht$LD$(LL$tHM`H|$8HLH HL$PDT$tHHE芃HI1PL1h1H59plAXAYITLpIH5p1mlD$dD$LfDIuϦũA;E#EHKhBL I9I|$HLHuM$$H hBI9ufDH訂H71PI1LfH5WokXZEdID$H\$(AHD$Yf.HHHLeSI"H5n1\k_AX@kL 1ɺ|1H5n"kDHЁLe1ɺ-IH5n1jH|$X\$LLfH5@nSD$lPDL$p1jXZHD$hHtHt$0H|$XH$dH3 %(yHĸ[]A\A]A^A_HHLdSI;1H5mjA[X @ˀH1SIH5mLe1i^_>H萀L!d1ɺvIH5Fm1iHfƅCfDH81LmIH5l1TiuM`@HLqd1ɺIH5l1 iHfƅ$`@HH=dBHfATL%dBUH-dBSH]L9t.HfDH}HP(HHZHHL9u[H=dB]A\#ATIUSHGHh8HuZHxXHt/L`HHHx_HH=:dB[]A\L)d1<H5|kg1L1ɺ^H5[kg[1]A\ff.ATUH-cBSHcBH9t-IHH9t H{L^uHC[]A\[1]A\ÐSHHHHP H[bYfU(HSH$_HHtHhHEHHPHH[]ÐLk1H5tjff.ATf11USH0dH%(HD$(1I)$LaH] CAt$Lc11t$H5iSZfHT$ H H9wTHD$H9tJHD$A1ɺRHD$LbH5iPP1fHT$ L1.aZYxXHD$(dH3%(H0[]A\c\H1ɋAH5JiLb>P1e^_@+\A8t+Lb1ɺY1H5 ireuDLib1ɺW1H5hGeJ}\ff.fH uCH9tHE11QH1ff.fAVIAUIATL%)CUHSI<$t]H]H9u -fHH9t#HCHt@atpXI<$HH9uE11HLL[]A\A]A^@;uDAVIAUIATIUH-CSH}tmII9u>H̀A`L9t-HKA`tqXH}HKHA`̀A`L9uE11LLL"[]A\A]A^@uDHtGauHCSHwXH8H[AWLhAVH5fAUATUSHHxdH%(HD$h1Hl$ Ll$0D$D$/cHLHD$@HH$HD$PHHD$HECH8H#Aą<11xIHLH腡IHt-ZHtLpHHJLLx1L`H5eDbHD$ ILjL H9u"7I$MLI9ILpH1HLHuL>LLAtLM~x"1L\IH54e1aL fAƆLAAI$I9afDLd$ I9t'HIT$1HHPM$$I9uLd$0M9t&fDHIT$1HHPM$$M9uL$Ht$HHHT$?<7L<$L+H߉E11LHH.HH;\BvuH LLt HH)ILg^1ɺpAH5c1J`M1ɺrL^H5c1&`fDHt$H.{H|$A.H4$H1HT$nLt$ M&LI9t"fD3LMQLM$$H9uLd$@I,$LL;$$t'f.LIQHHmH;<$uLd$0I,$LM9tfLIQHHmL9uHAt$t D$:HL$hdH3 %(DtHx[]A\A]A^A_@HH=6 Hj Lc\1ɺ1H5Ib^DL<$HL!H|$GLH߉E11LHH,HH;{ZB:H LL1L\pAH5a1^M1ɺrL9\H5xa1]fAąL1ɺ1H57a]hf.H1L_[|AH5`1d]E11HHHH<$HHD$!!@La1H5`]H /f.La1H5D`\uSHH)IfAUIATIUHSHHdH%(HD$1D$H9t%fH{HCHH`H9uHLD$LL\T$1HL$dH3 %(u H[]A\A]1SSE1E11HH0dH%(HD$(1Hpt$uHD$(dH3%(uDH0[D$Hct$ HHH HcH HH qHtHRAT1UH1SlqIHuRfH1HHHPCau%LHHHu[L]A\qfDHfD[]A\ff.SH$CH;tiH;1NH[AUIATIUSH8dH%(HD$(1D$ uRH1HtKHl$LcHHHL1H1LD$ LsHKLT$ 1HT$(dH3%(u H8[]A\A]@QHECH:tfHHf.HtG` tSG`Htt̐H߉C`[@3pLX^1ɺIH5\1OYHCsXH8MH5C`H߀̐C`[cSG`HtĀt̀H߉C`[<@oL]1ɺIH5i\1XHCsXH8HC`H߀̀C`[AWAVAUATUSHHDgT2JH߉0oHt8/tnCTHHS8LWH5[PCXIIPHAH % кP1XH H[]A\A]A^A_DS`cDkTDsXAAHǺ@1KAŅ8{XO&{T>FK`kXHDkT0nH1ɺAUI1LWATH5ZU>WH 'DCTHHS8LUH5Z1PCXIIPHAH % кP1VH DcTDkXDD!HqmAULU1ATIH5Z1VAYAZrhfDkXH%mAULVUI H5Y1;VYD^DŅL8 JHHlU 1IHs1PL{,1H5tYUXZf.΀H߉S`H[]A\A]A^A_@HhlHDLUAUIH5Y1}U_AXgDKDsTDkXHD lHLTAVIAUH5X1AT'UH fDHkHDL:TIAVc{KD{TDsXHߋ(kH1ɺAWI1LTAVH5EXUTH AVAUATUH-ޚCSHH}HIsXII΅x%MLLRńt1[]A\A]A^fDHsXH}HjAULTATI2H5W1SXHZ+[]A\A]A^H1jLX#IH5IW1SQf.H1VjAUH5WATILS1+kSY^ @AWAVAUIATUSHH8HT$Ld$LdH%(H$(1HXH1"iHHFL)X1H5jVRfHH襑IHt-JHtLpHLjHiHјCH8wLW1H5USRL|$M9H\$ E1D@HLIoHH^HٺHa1HC HS(I3EI3UH HC0HS8I3EI3UH u{IGHt$HHLl$I]LM9tLICHHL9uH$(dH34%(H8[]A\A]A^A_f.HHM?M9fLU1vH5T QŅzL1ɺ1H5hTPH1fLiQ1H5$TPGAUATUSHH $HdH%(H$1HIIHHLg1HٺLmMtAEHLABELONEH9$HLVM2 001H9$MtAEfo$ fo0A$A$H$dH3%(u~H[]A\A]ÉL71ɺH5R1MOL{fL1fL11H5ROm;Fff.HHыwXHH)CH8qNHCwXH8:Df.UHSHHdH%(HD$1HT$H$D$D $D$AAt.==t/HLO1ɺP@=t4=tiH1ɺPH5QLO1MY^H)CsXHH8DHD$dH3%(ulH[]@=tHLyN1ɺP1H5Q~MXZDL91ɺH5PQMDf.HCwXH8*Df.AVIAUIATUHSHñuZL%HCI<$MHtC`t ĀsXx@I<$ILLLńtHI<$?ń[]A\A]A^DK`HsX@H(cAVL"NAUI[H5O1=LXHZHk[]A\A]A^HbL}Q1ɺGIH5O1KsXI<$HK`H@HbAVLzMIAUcSH1VbLLAIH5 O1oKf.H1bAVH5NAUILL1T+KY^@AVAUATUSHHVdH%(H$1HHxLNHLH HH=@I1I@LLHLL$HHLABELONEH$HD$ PŅIt$ϦDt$HkLD$aAVLL1UIH5M14JXLZjŅH[LH HYLLHL(L1ɺ1H5OMIH$dH3 %(H[]A\A]A^fDH1jH5L1LK\IY^ `LN1IH5L1"IfDL_LNIH5L1H-@LJ11H5RLH?AVAAUIATIUSHNuyH-ӎCH}HtC`t Ā*{XKt%HsXEtCH}ELL0It?H};H߉ń&[]A\A]A^fDH}LLHuH^AULJATIH5PK11GXHZjH[]A\A]A^K`H!H1/^AUH5JATILH1DGY^,DH]LL1ɺIH5J1 GH}sXH]AULHIATfDH1~]L:IIH51J1Ff1DAWAVAUATIUSH(dH%(H$1]L1I1ɺzIH5I1,FLD$I$D$1Hl$HD$L-BB1@HIHI HLL.HLABELONEH9D$uEH9\$tiHHuH$dH3 %(D$uH([]A\A]A^A_MuM9uDM6M9tI~HHHtL[H1ɺSIH5H1LYHEY^LLrtnH|$1L?H8H+fL[HLGSIH51H1D_AX@LH[HLGSI1H5G\DXZD$DL[LI}IH5G1DpO;f.DAWAVAUATIUSHH1!HHX IH1fD;u H{5lH[HutqHc;IHt\I] HtOE1f.H[Ht7;uAIcHK1E)LHyIc1A9~ H[AHuM4$H[]A\A]A^A_ff.fUHHSHHdH%(HD$1H$蔼uxHH HHHt[HH HHHt>uH{8HJu>HHtH<$u1HT$dH3%(uH[]H*tu9DSH5GHdH%(H$1H|:t81DAu(H$dH3 %(uDHĠ[f.H1ɿHgGLJPH5gG1AXZ8f.u7S=+5uO0uz=[L1ɺk1H5FA[D=71ɿLFDh1H5F@=/t@LF1ɺb1H5~F[@fDUSHD =EAt11LF1ɺCH57F`@1H[]H=F1=4Ņxwމ3u-\=H[].t6H EHL7FDQU11H5E?XZ1H[]DK6HrEH1RDLEIff.HH5 H=EI9HtdH7u01LE1ɺH5EG?HDL1ɺ1H5D?DL1ɺH5D>1Hf.SH5]H=ZE8Ht?Hǻ6u[f1Lw1ɺH5fD>[1LO1ɺH5>Dg>[SH5H=D8HtWHǻz6u[f4H1ɿHCD1LDRH5C=XZ[D{4H1ۺH CD1H5CQL_D1ɿ=Y^[HH=.D.u H4H1ɿHDLBDRD 1H5-C[=XZH@ATH5UHH=BSHdH%(HD$16H1H8HH$c*I.HMHMAHF1+,H8u7H߻5ufHT$dH3%( H[]A\#3HH FBH5NBQD1LC.1c<Y^2HH B1QDLtC11H5A#<XZ^@2LB1ɺ#DH5AH1;H=A,ÅHHA11PDMLB1H5uA;_AX2fDAWAVAUATUSHH $HH $HXHt$HH5 IH= AdH%(H$H!1D$<HD$XD$@D$LD$P4HILTB11ɺH5@H$L5BB:HEHD$`HD$hHD$pHD$xD$HD$LH=6B(,H+1H=6B#HL=6Btƾ L%0HtLLH=ALH=AL H={AL! H=gAL H=WALLIALLAAEE1HL$`H=5B>HD$`HT$xL@LL$hL\$pHHT$tHL€UMtH=@LfMtk1HL$PHT$LLH5@,uKT$LD$PHHH HH!H H H HH!H H$H|$t8H|$*Hv(HD$x-tHpHG20HHD$ HǹHHt$D$XLML?MPD$\H5=PHP17H L\$ H|$L藰D$!DHT$TH5D$TH=3B*u;D$TL^B1ɺH55=1\7AEL/T$At AEbH$H!dH3%(DHX![]A\A]A^A_fDHT$XHL|$XMtH533BL.]LNA1ɺ1H5{<6H|$X(AEL.>LD|$.DT$HE1.HL$HHT$DH5=H=2Bc)DL$DAH1ɿjLb@H5;jD$`P15AEH L. @11KIHSD$AϦH$@DLHmtIHqtLHHtLHMtLLHHDH H!%tDDHJHDщ@HHH){rD$AVfD1ҾHIHHH=1B, H1H5i:1AWL 0BL?{4Y^AE@L&HT$XHFL|$XMtH50BL}+tL>1ɺ_fDLJDL$H58 3AEfDHL$@HT$1ɺ"PH|$HpL\$(LL$ "BLL$ L\$(|Iq!L\$ HAL\$ sH1ɺD$PL|<H5 8PDL$T102_AXAE[)DT$(L:1ɺSDH5711DT$= =t NfDATIUSH/H]H9t$HfDHH#HHL9u[]A\AWAVAUATUSH@t uE1HD[]A\A]A^A_@HH<$脦 ''116GIHtAH<$LoIHHL萪uLGH+IH9uHmH9tH}L'uHttAD$b MI$LLHHD$'fLE1GHUAWL<t$HIH P0H1 I H55RAA 10H @L<1ɺ1H55/BAŅnL1ɺK1H5}5/KL(FH+H9taL%<ft?t4<-t0L1LLHt[LHHmH9uEJL;1ɺ1H54.#f.HEHuAVL;AWHIH H0I V ȁA1PA Ѻ4H5q41E1.H T@HEHuAVMAWHIH HI 0V A1A P<DLE1DHULu:P1HIH H0I ARA ɺ1H53-XZff.AWAVAUATUSHH $HXE1dH%(H$H1HD$0@tHu3H$HdH34%(D9HX[]A\A]A^A_葢yAtAL:511H52E1-H5H=2&IHM1(HD$8'_ʡAŅOH|$8L|$0I8HKMLAH41AL1H4LHWHL$0LL5H4HID1~H|$0DLHHL$0LH4HID1BH|$0L1Ho41ҾH"HH HH54L1DH|$8IHKMLAHb51艠a,E1AϦ+L'cH1H50EAWL8:1*Y^^AL#t)O!L81ɺEDH5t01*HfDLH=13_$11@HD$HtHD$@E1AϦH$f.Ht$HiIHtLHÒHtLHuAFbtL@L7IH5/1)軞zfDLq1ɺ81H5^/)wfL8@H<$H8H$ H!%tDDHJHDщ@H$HAH)HfAAF`KI1LHHD$2Ht-HHt HHD$裵Ht$tf.H5yIF8Ht$(IHH IH DI0ҁA A LT$DL$$ ?Ht$(LH1VT$ RDL$4H5LD$ _AXf.LEDH01TH|$>DLH=0!fLH=/!fLh>L51ɺIH5]-1'?H=-LH1H5-D1VL0H5-/'XZRc@ufS11HL/~H5,&tBu1-H{gtct2[Li1ɺH5S,&LA1ɺ[H5/,X&L1ɺH5,1&y@L1ɺH5+ &?@@ufS11HL.H5+%ftbtyu1tH{Btv[@LQ1ɺH5;+i%L)1ɺ[H5+@%L 1ɺH5*!%c@L1ɺ[H5*$@ufHGt HfD1ɺHLH5w*$DAWIAVMAUIATIUSHHhdH%(H$X1Hl$0D$,HA$@tx0E1H$XdH3 %(D|Hh[]A\A]A^A_ÐHD$@H5}*HHD$b2eDHD$At0H1ɺH9*L-PH5n)1#_AXHT$H5)AHD$DA2uHT$,HH"HDL$,EL11L,~H5("H#Hru#A$~fDD$L+1ɺ?H5\(1"DL$LfL+1ɺ11H5&(O"A$E11ɉD$L+1IH5'"DL$tuu!DL$HDL$A$fDH1ɺH(H5w'PL+1!Y^-@DL$&DL$tD@1ɉD$L +1XH5"'K!DL$u!DL$|DL$A$f1ɺqD$L*H5&1 HHKDL$HDL$ct]11L*H5e& DL$u!DL$4DL$A$%L$1{TLHHCXHHD$H</@/HHH9D$s&L HD$HL$HZH9uLnHD$HH\$0H9uHH9Ht$HuIEHHD$HT$I9DHx7Ht~Ld$0HXI9u nfM$$I9tcI|$HzuMtMH|$Ht"A$<-ttI$Iu!H\$HHHL譗A$HD$HHD$I9t!HT$XD$Lh(1ɺi HD$H|7HHELLAۘSLs,1ATAH5($1TXHZLטH|$]AIEHHD$HD$HT$I9HD$H6lH|$HD$H2IEHHD$HT$I9hH|$IEHD$HHD$HT$L99H\$zf1zDAUATUSHH $HH=i+dH%(H$1HAÀۅurHIH 4*BIH,+L#DL:zÅH$dH3%(H[]A\A]@I1IH )BH*L]#yH71UL )B1L*H5*GXZuH21UH5g*L Q)BLu*Y^>fLɼ1ɺ<1H5(*DUHSHHH8|1HHFHCH&HCH HC bH=(BHH*to@H=(B\H=(B s11\u H[]fH=T(Bu1ۃ8H[]I1L)QH5)H[]fDHHH=(tH7Bt#7Bu7Bf.7Bu 7B7BtBH7BSt7Br7Bh7BHt#Ѕt W7Bt[eDt蟇[IfAUAATAUHSH1ҾH1ɺEPH5r(L)6BD-6B6BD%6BP1ATS`H HH=6BxH[]A\A]H=I(H\1ҾH<1ɺEPH5'L^((6BD-6BD%6B5BP1ATjH 1HH=5BZ1L'H5E'l1D 5BH[]A\A]ff.@5Btf%5Bff.@AWIAVAUIH=#&ATUSH(dH%(H$1LÀ褤D4BAELd$LL'yD 4BEt:D4BE=4B54BDt,t1L@趋AfDL谋AH$dH3%(DBH([]A\A]A^A_fDA)3B 3B3Bu\At D!1DLL3BDL 3B DL`&1H5%#E1D$ M1L%H5$DT$ A tt@D$ 1ɺ1LtH5q$2BDT$ tlDT$ WNDLDT$ OfA tF11L%H5$%DT$ 辂DT$ L%1H5#LP%1H5# fSHH=#IЃɹEu51H5"HBkt-W8u1H z-BHteH=   .BH{H=D-BHtHH 1HQV=H:@HAV=H@-Bu-BH-BHHtHH=8=cff.@="-BD= -BDSH=,B,BHt&H,BH,BH,B,B[D,BDHu,BH%'HHDfDSHHaH[ff.H=+BHt HGHt+BHff.@Hc<Hff.H<Hff.AWAVAUATUSHH $HfHt$AAT$ AL̓LD$AdH%(H$1)D$p%)$D$$=F=%D$ u#5A+Bu#AA tME1RZ*BtHt$H=u*BAA%qEtEt *BuD-*BH=*BLoMHELL$XL$LD$LL$XHD$hxDI*BEAEH *BHL2H!%tL )BDHrHD։@HL)LMXL;)BMt`L)BIM9sPH)BHt A HAHJI[ tA4$A1 HHK)BDL$EH=(BHLHYL(BMD!lDD$$Eu YH(BL (BL\$@L(B=(BH(BHT$8D%(BLL$0L5(BLD$(=n(BHD$HL$LD$(LL$0HT$8L\$@|$$H5wHLjATL$ATRHAVL\$@RXH0L\$AH 'BH.L\$H=KL\$H(BL'BHuc'BL@H=1'BL|~@Lq'BMD!H'BL$H1MT$ Ht$E]H$dH3%(HĨ[]A\A]A^A_@ B'BL&BME Dd$ExT'BJE1Cw H<oUHELL$XH LD$HH5T$XHD$hE?n9D&BED &BEh&B|$p D$pLt$p 3L H=e6BL =L1Ho]HEHL$XH=.6BHT$\$XHD$h H%BH= 6BHt"H%BH=5BHH%BH9H XH=5B,%Bt7%BoeHEHL$XHT$d$XHD$h E DH='H dI E1[Me]A\A]A^ÐAٹL!H5@L11kH5zE1DHD=L |@AL1E1dH5)~IfALF11}H5GfH1D=L ff.SH5BHH~u 1[fDH5BSH~tߋSH5BH~~[@AWIAVAUIATUSHHaC=HH9HC=H9HvC=L5GH9"Aą H_D 9t+P1EUL H5 XZDLHsH;BVH;B9H;BIEH[]A\A]A^A_@1LH5, |H1[]A\A]A^A_L5w5Aą8.HMLGPHEcPHP1H5 H 1H[]A\A]A^A_Ds8A>MH HwH5f HDHLPHTP1RH DSF8_A>MH CHHDHL]PH H5 P1R$H D8A>MH HHDHLPHCEH5m P1RH L5sH19fHiB@HIB@H)B@8TA>H @HHDHMPHfLJPRAUATAUHH= SH(dH%(HD$1~BIHt6HlH01DHH!tvH DNutn^EH)H5HHDaH'BHBHD$dH3%(H([]A\A]H5H=IHQHHL$HT$ 1H5 .L n1ɺ1L H5 LH= !HHHHB1H5t/IL 11H5$ tHBHBfIL 11H5,yHHIt$DL$H 1H=BY^AH-sBfDc8HL , PH>LPHPH5?P1H  8d}IH HH HDHLbPHH5P1R)H 8 L x 1PHL~PH51XZL- 1ɺ1H5kDBf.=%BufUSH=HHHt/8>t71 H09uH=B0u,BH[]fD1Hx 9~f8=BH HHDHL BPHPLH5u1R4H mfSHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HBHtxAAADHBHtfHBH$IHD$HD$ HD$$(D$0qHBHD$dH3%(u&H[ÐH:=HyH:=Hff.@foBfo BHfoBOW DoD$oL$oT$()CB) LB)UB@H=%B@=BD=BDH=BH5Bff.fH=BH5Bff.f BufHH IjL yH jH=5PHRHPHVH5P1aHHff.SH5H,tSH5lHt;H5<Ht#L11H51҉[f.fSH5|HHdH%(HD$1D$HtgH@ H@XHtZ1HT$HЅtJD$HIٹ 1L H5P.fDLy1ɺ1H5HF HL$dH3 %(HuEH[HyLa11ۺH5XHtHqtHzHESHLHt[fDH{ L#5IH51@H[HGH@ t/HB^u'@u"HHsHu4HH@t LuHf LtHDUHSHH5}HHquEH[]f.H5>HAuEH[]f.H5HuEH[]f.1IٹWLH5w1afUH?SHHHdH%(HD$1蓗Ht~?HH~Ht9H|$HtT$HL$dH3 %(udH[]fDoLtH5>H=HHe=`D@AUATUSHHOHAPL HGH@HHAAuEuOH u^IEt~u2ALu.HCLHphALH[]A\A]ALH[]A\A]fHIHGXH4H ШupIDHLtIH51 H1[]A\A]ff.HH@@\u f.HHppLtHfL91ɺ1H5Hff.AWAVAUATUSHHLwPHwhI>y1HIHHIHIDL,@oI HL9rM9H[]A\A]A^A_fDHoI>HHzHHD$]I>HH$^HL$LIH5'1QHT$R%_I>LAXI>HH$HIH$LIH51R)AU5AY1AZM9HCPHH8HII>HIAUL\ATI1H5Z1XMZL31H54H1I>IH/LI>HHHH5SILZ17QY^1H[]A\A]A^A_ff.ATUSHGY@uHcŅtE[]A\Ð1LeIH1H5[[]A\HL%qYHt Hx;IH0HPL0ATI1H5sXZ[]A\f.USHHGY@HCXuH&rHf.HHuQH$rJH'rCt Hu2HZu&H让uHCXtU uNHHHH]lHEsHsLUI1H51wXZH[]@L,1I[1H5:H[]ÐHLcIH51ff.@AUVATUHSHw?ukH[]A\A]D N@HI>HI1AUH5ATIL1fY1^?tH@HIHLATI1H5XZ1H[]A\A]AWIAVAUATIUSDHHHH$$HL$L$HD$L$dH%(HD$81AHHD$0蹴1AuIHDILP?IL9LuADžAuH951HHHHP1H@H HDHHH|$0HuHD$0HLAVLL$t$LD$@_AXZEdA6LAHoL1ɺIH5;1HL$8dH3 %(DHH[]A\A]A^A_DLCLLD$ LT$LT$LD$ AE LD$ LL9LT$LT$LILLT$(HD$KLD$ 1H5AP@L1AWLL$(1LT$8EUD_LAXADž`f.Ly1ɺ1H5f.LI1ɺ 1H5_f.H51LI1'AufDLE1HH5PHD$ LLH(1Y^)@HLLD$E1L$YL$LHLGAuLH8HLD$I1H5APLsUSdH 1LH5<LLTLT$ LD$ AEAEAD)AI0AVAUATIUSHHdH%(H$1HGPL(LHID$XH%r L@tL2fHHhH5lL蘟IH<H %HLHHWHeE111LpHHI6BC] uhID$HxhH$dH3 %(HdHĐ[]A\A]A^fDL1ɺH5711IHKH1HLc1LHL;n[L,1ɺ1H5BEDI$HRhHPh+L1ɺSDLс1ɺ1H5ufL1ɺ1H5Mf.H16LIH51DAWAVAUATUHSHH(H4$Lt$dH%(HD$1JHHD$cI@LH AąHT$HBTHH={tL`(LhhH:ÀMUAKH3IE;HE11ATL H5kXZEY=ALJ`HpAąHEPH8Aą* xMHLIH5q1E`EeE1fHHID1ML-H5@H11AU_AX LCNfDH1H5E1ATL1.Y^EYHL1ɺIH51L~1ɺ1H5]HL$dH3 %(DH([]A\A]A^A_fH:AHL1ɺIH51f@H$AALJ`iL}1ɺ1H5;f.HL IH5a1H|$AąHEPH8+AąHH(LIH51qALJ`HmAą}L}1ɺ1H5-YL|1ɺ1H53=ff.fAWAVAUATUSHH8dH%(HD$(1v_HHCXH0H2IHCPE1E11ɺHH8ADžuvHEHG] LNEHCPHkX,HH8hDHHsX,f.Ht$$HADž`HLi=ADžfHL`Lk7LHpuADžH@LL0HD$H8HD$H HD$2^H5dHID$PH8蛗HEHHADžE11H1H4ADžA$HIl$X2I$L0MtBHD$H HD$H@HD$H8HImX4ET HHE111LH9ADžjHL6ADžuTLQz1ɺ1H5gfHL1ɺBIH514H;ADžHAADžNA8fDHE1La<IH5^1HT$(dH3%(DH8[]A\A]A^A_Liy1ɺ1H5 DLAy1ɺz1H5WD[LHL _IH51>@HHL`u:ADžZLHrADžL@ADžLx1ɺX1H5.Lax1ɺv1H5wfL9x1ɺJH5Q~@Lx1ɺ1H5'TfLw1ɺV1H5,f.Lw1ɺ1H5]f.Lw1ɺ1H5-f.LYw1ɺT1H5of.1ɺE1LwH5>kfLv1ɺ1H5H@PH8YH{pHGPH5YL LԌD$HtH@ H@XHtr1HT$LЅtbD$1A L^H5E HCHhX;H11ALH5H{kLIH5D11yDLHH5XHPHGPL L請D$HtH@ H@XHA1ɺ1LH5,1ALH51fDHxGfD1A LH5DAWIAVAUIATEUSDHHHFPH|$HH@HL$ DL$HD$(HFhHD$QHHH@HD$8ZLJ$H$LEH|$DIGP,M4I9DHD$0HD$ HH=7HL$ HH91HHHH|$HH)HHD$ I]21M)LBH5@113LT$ MgM1LHt$0HHPH @LH HH9HGH9Ht$H|$I)1HLHt$0H9H$3H$H|$(HD$ HH$H$H5~H8=lHH|$(1HqIHLkIBHu@H@HHP :uHrL€uLHLT$tLT$L@$D$Ht$H|$$fDL H51E1HHD[]A\A]A^A_H\$IUhCHALHt$H;A7fH1HHLHH)*@H|$LZIH5o1E1VHT$H|$A܂Ht7HHHt.H\$HH{t H{ H[HuH\$fDE1LLT$LIAV1LJSIH5S1AW;H LH1ɺATIL`H5t$0D$4P1H HD$8LT$@\t$cAE\@D$DeTAHDžHHD$ H H(L0HPLXHDž8HDž@DH|$IQ.1MLH5@11'HJ1HHM fDD$Lh1ɺH5[1DL$@QL1ATAMH5XZLBfDHt$ H;軾HH|$(1H\$HΉD$mIHH>IDL1ɺ1H5LT$L11H5oLT$H|$HcI,1M#LpH5%@11MDHT$H|$@LH$HH|$qH$HLSH5E1HH|$H)HH\$ H+LT$ I1ɺ)LH5LLT$ MLH\$ Lgf1ɺXH5E1L1ɺ1H5VLT$rLf1ɺe1H5+E1Le1ɺs2IL11)LT$ H5pLT$ MLHff.AWMAVAAUAATMUHSHHGH@PHHD$LLH"ÅDHÅ3HEH@ IE@AD$TI|$2ÅBLd1ɺ1H5t%@Ld1ɺ1H5MH[]A\A]A^A_fDLod1ɺH51DmTDHGIHEEth@ I|$DÅ'HEH@El$TH kLc1ɺ1H5;f.H@ HEH|$CHPh\Au%HEH@H 2H%I|$ÅE9l$TtUL|$DLH}IAt$TLHAV1ɺSIL[H510ZYHEEl$TH@H _DLb1ɺ1H5}+Lb1ɺ1H5WEl$T>f.USHH(HGXH-H4s=HLIH511\H([]H,HHCXHCPH8h*ŅfHsX,H)$)D$D$ jjt$t$orH ŅtUHCPHH8*uHjLIPHd:HCXH(LdIH51qw@HLIH519H([]AVAUATIULSHdH%(H$1IH<IHLHL`1ɺ>LH!ʁ tH€DHHHD@HL)DpLLHAr~HxHH$LHH)HKT5H)DJT0HHLH辏ÅH$dH3<%( HĐ[]A\A]A^fDAEtAUtCT5fBT0IH1HLLe_1ɺH511yU@L9_1ɺ1H5O+f.L _1ɺ1H5]f.AUCT5BT06fDAUIATIUHSHdH%(H$1HHHHaAH=HD$@HD$8HH5AE11HHLRL$|$Hu_HD$PH|$8HI$HPIT$HPH@IT$ID$FH$dH3%(HĘ[]A\A]@HHZL(PDL$X1H5¼XZH|$81fLlJH5莼1fHL\OIH51QHLTTIH5Y1TOff.@UfHSH8dH%(HD$(1H)$)D$t.H$EHL$(dH3 %(u5H8[]fLg\1ɺrH51}趲fDATUHSHHwHLgPdH%(H$1HHH5H0Hts1HL=t HH5^L HI|$HHteHEHH$dH3%(HĐ[]A\fDH0L1ɺIH51|f.L9[1ɺH5Q{@LMH1ɺLH5^%O[ff.G[tUHSHHH3u H<4vH1[]fDH`HtHPHRXtH2rHH9XuH[]ff.HHH9t:fHPHt HJHtHhHt A[tH9tHH9u1@fSfHH0dH%(HD$(1H)$)D$1҅tHT$HD$Ht HH)H H9H\$(dH3%(uH0[ff.AWAVAUATUSHH(dH%(HD$1DLcPHI$H$<D$HH@@LhMHLpM{HLHT$蓱HT$AHsXLHHǂhRADžL脑ADžHwOLHHHL1ɺXIH51hH<$H"ADžQL 1ɺ`1H5n0H<$HT$HADžDD$ELlADžyH{L\1ɺvIH51ǶH<$H"ADžL81H5IL`1}脶H<$Lh INXL1ɺH5IL{1)HHH@HP+DsLEAFE1D$fD_HGPHxHNHpH9a\@HWP'Hr 1H>DHGP@ATUSHo@HHHM1ҋpTHHDHHHCPH8H9[]A\]fDHGPHpHx[fDHWPBulH:tmH9zug1@HG@H@@trGpfDHGP@8u.tqHp Hx[@uHGPHpHH+x[f.Hrg[f.Gx@Hz(?[HpHx+[HAPH8|HSPIHEH2H@PH8bH}HFAT1SIL:1H5ϧrXZ[]A\Hr0Hz ZHrHzZH8H1AdH%(HD$(1HGPHE1H8{t $tT$ H|$(dH3<%(uH8;iff.ATUHSHH0dH%(HD$(1Ld$Ht$HD$ LD$ HD$LH5H萦tlHT$ H iH5PLӦHCHD1 RLKH9BqY^H\$(dH3%(D$ u5H0[]A\L16H5<pk2hfATUSHH9t8IHHH9t HsLt[]A\fD[1]A\ÐSH0u?HCXH0sH2s]H$r6tH HxXu$1[ÐH[W1HHxXt)H[H@XH[HH@HCXH$sHHt;H[Hf.HxHxXuHCXMHCX1HvH郦SHHHtHH[1[@UHHSHLFHdH%(H$1HFPHHH1ux1HHH$dH3%(u;H[]f1LIH5n1eUHS1Hl0u4HEXuuH"s/HiHHt@HXHH[]f.H!rH.rH/rH&rH'rL1ɺ1H5GnDSHH@H5ІHtHpHH[ǤATIUSH=HtXHLHHxtHH[]A\,@LY1ɺH5qm[1]A\f.La1H5|AT1USHPHH3qLPHH HXHIXHMdLHHtf ILHHHi1mxH[]A\H5 @LH5611eL{1H5 ef.HNPHH>AV1AUATUHSHPHHpL9IH HWLIWHI|WOd&HILٜHHtq輯 IMLHH 1Hkx#H[]A\A]A^H5}ܛ@L%H511dLK1 H5ܙdf.HHv HtH@PHxff.SHHHtHH[1[@SHHHtHH[1[@SHH@HtHH[O1[@SHHHtHH[1[@SHHHtHH[1[@SHHHtHH[1[@HGPHHx"H@SHHdH%(HD$1CZtIHtDH輌Ht7HpHCPHL$E11H8荃ÅtW1ہ|$.Lɛ11ۺCH5zbHT$dH3%(u+H[fL)1ɺI1H5?bxYATUHSHdH%(HD$1ܗAąE\HHHx}\HHPBHLt0HH9jt:H 1f.HH;jt&9uLMHuLJm1fDHxH脅AąH$E1<AAf.Ht$dH34%(DH[]A\LMH\LkH5:1E1`LMHdLcfH@HjE1LiLHHuH1H5Օ`XZSLY1ɺz1H5o`*WDATAUSHHdH%(HD$1HHCXHGH HHHHEH}@6HAąHsXH TDULEHH!EB1H"1@H@tHH;\t0@tHH;\tDHHHHI9uDE9(H$E1<DAHt$dH34%(DH[]A\HtHxYHDLKHLsH51E1^LKHLØfHLOHsH1E1LH5~^XZ7H<$DE1/THAL1ɺ1H5o/^LKHL%KUff.AUATIUSH(Hn dH%(HD$1qHHHEH8HEX #@cHEX C-}`$uLDkHEX@t^OHBCHEX%HHmCTh-fCHEXH%H$H-CCHEXH$H%o-CC-HEXCpHEXHH!HƒkC HL$dH3 %(HOH([]A\A]pHEX CwfDCtHEXH$RHHHHH!zHH-AT$HT CXHEXHHEXH%H)HsMfDjA$A|$H El$EE\$ECsED$(Et A|$HHEXH%s A|$HH0s A|$H{rt At$$tCRA|$ྃoCwf.XXfC_f%HໃrCH4WH0LH肄fDH1ViLIH51NHfUHSHH+]H5(tH(H58gHlHEHH[]&fDHFhH5gHtHpHHfHHDfAUATI UHSHH= HUXH%H"rH!sHbRHUX EHLI9.HCH$HxHGXsH$rlH2rMH-Lt=Hu-HCHhH HHH(DHI9HUXfDHHSHH9tHzHGXkHxulHLL9uWHL9tHHCHxCtHfLkIH51@LHCHhHH[]A\A]f.HCHGhHtfHGPH@XHHǰH9tCHPBt$PL@HH9t*HHAt HLt9t1HH9uָV9WrfDHHNH9ff.HLL9tAfALt)H1HRH׃:u HRR9ALwH L9uȸfHWXH0r%uH%r@utLfDHgHHxHWXH0ruH%r@uuHHHfDAWAVAAUATIUSH(HFLH.HD$HHD$L9DAGL1ۅufA9_LIH @HHʃ:uHEH9t%HRHr1H9pHADH9uuH|$(HL$HHL$HIIHDHxI}IT$PL H5LP1At$HEIZLYHA9_L+fDM?L;|$H([]A\A]A^A_1LH5 HH(1[]A\A]A^A_ÐATUHSHQIċE`C|Cf1LH5Tz,?1`6AW$fAVAUATA1USHHXHoPdH%(H$H1H|$ )D$Hf7HEH(HCXu}HZAŃu{HAAƅEE,H#tHgL1ɺ1H;Zt^t#L1ɺH5%y1=1H$HdH34%(HX[]A\A]A^A_fDE1HtAC^+ffHC[LVVLd$HLD$WHIQH=2VMH xHZH5xHDEHDEHDH1ATLD$H=reZYHE1[D]A\A]DLq1ɺ1H5t9$LT$ARH5kL kLT$VAUATRPH PULky18 H5j^/H@L$ILcD fHD{HHx@EI>HL &ktH GQQAUATAWPRU HGL jRRAUATAWPHPULx18 H5i.H@IEfH[]A\A]A^A_DLTx& H5iv.1L=1ɺV H5}iU.H1[]A\A]A^A_@ eLv1, H5?i.D1LwM H5i-19HD{HHx@DI>HL iHFL iRRAUATAWPH#PUARH5iL iLT$VAUATRPH3PUff.SHHQH@@t HHBH8t0H[HQHtH[fDHQHHL$HL$tHq9^v9^vHQHyAE1ɋJ ÅuL1ɺu 1H5g,nAWAVAUATUSHDaEuQGtJHHL$IIH<$DxA@DEt0HT$HHHBH8tH$AD9`w@1m@HHH,$H]H9u5fHI~ E11j1jjfH uHH9tIELCH0MuI9uEuH[]A\A]A^A_fDAM Ht$E1EH<$LÅuLX1ɺ 1H5fn+ff.AUIATAUHSHYHHHvVHtHD[]A\A]I}(bHt%HUHHHPʣHD[]A\A]@L gE1WH5e*됐AUAATIHUSHHUH@@@u+HCXH$r0 uEu\tI|$uf1H[]A\A]ÐHHxXuHHuHCXDH 8ŅuzCYHD1LrtIH5e1)AT$ t CYaHYDLbt1ɺIH5d1)2H(DLs1ɺIH5d1t)I|$uAL$JAD$ wDAWAAVAUMATULSH(H|$MDU DU$E)A9DGMt E9UDELLMEIqDIy11҉ƉD$DD$D9T$FD$A|$hD$JEtXD$`E11ۃD$D$pD$H@HH ЋtF;]LsE;\$`v΀|$uNjD$pDL$pH(D[]A\A]A^A_f|$hDDE|$h+E 1HqMt$HA$$$P1AW#D$DE1PL$@H|$8H0-OAp@T$hHqH|$H$ڃ|$hDT$xu1ɺD$L2H5ybV'DL$@EUDELLMEJDT$D$[HEA@HHHE1E1$1$jjjH|$8H0AD$L11H5a&DL$ZfD1ɺD$LAH5ae&DL$'AAtEu AHDELA@H։L$H臩L$HHHLKH1AWLpH5a%ZE1Yff.@SHL EHH@dH%(H\$81HHL$H$IDH|$H LD$H$WHLHL1ɺ1H5[U3fDHLHID$XD$ @HLLHvtHLH`L1ɺ 1H5TLp1ɺf1H5THCLHL)1ɺ1H5gT? f.H;LHH YLHHULHzjID$XD$ H:LHH@Ly1ɺ1H5SYf.LI1ɺ1H5S_Zf.MufL}@iH `HV]LHHlLHqID$XMuH}oD$ Iu HSHfDLI1ɺ1H5Q_f.L1ɺ1H5WQ/f.H"SLHt:HULHt$HRLHr f.L1ɺ1H5Pf.IuHHLN1ɺH5PfHOdLHHjjLHHt$$Lt?HULHHQLH|$$ LHhcLHtH\QLH4Le1ɺx1H5O{fDHl$H\$HuEErH7HL1ɺH5=OeDID$XD$ fDL1ɺ1H5N"fHLHNtH}LH8uLm1ɺ1H5NfDL`YID$X3fDHZPLHlID$X@L1ɺl1H57Nf.HaLH~HRLHdD$ HYLH6HRLHID$XMuD$ fDH[RLH&HOLHA$SHNLH9LԲ1ɺH5MhL1ɺ,1H5LL1ɺz1H5LfHWLHt:HQLHt$H+LHf.L 1ɺ11H5GL[f.Lٱ1ɺ1H5Lf.L1ɺ|1H5K;f.HHDd$,DT$)EHu-DLA1ɺ1H5KW!fL1ɺ1H5WK/f.HMLHLϰ1ɺH5 KHuHRH_L1ɺH5JHǙLHDID$X@LA1ɺH5|JY@H?1LHtHGLHL1ɺ1H5'JLï1ɺ1H5J$HLHRtHGLH<Lm1ɺ1H5IMHJLH$L-1ɺ1H5kICL1ɺ>1H5EIYH?LHD$ L1ɺH5H sL1ɺ1H5H Lu1ɺ1H5H HLHtH~MLHHL1ɺ1H5]H5 HD0LHL߭1ɺ1H5H IL1ɺp1H5G KL1ɺH5G uHOLH$LLU1ɺ"1H5Gk L/1ɺH5jGG L 1ɺ1H5IG! HaHLHLˬ1ɺ%1H5 G 5L1ɺ1H5F HHLH4IG',HGLHL1ɺ51H5YF1 @HGLH2L׫1ɺsH5F kH_GLHhIG@ kH8GLH)QLZ1ɺC1H5Ep HFLH L1ɺ,1H5SE+ HFLHLժ1ɺ=1H5E ?L1ɺ(H5D HFLH@hLq1ɺ/1H5D HELH(L11ɺ21H5oDG L 1ɺ9H5FD# wHELHLͩ1ɺ@1H5 D7ff.AVAUATUSH|1H߾A:1ҾHD,AƻD, txEA9EtU ݉   ݉ ݉!AL'T11MH55C D ؅u[]A\A]A^}1@1A1ɺSLSH5B[]A\A]A^D5AL6S113H5B| AVAUATUHSHH9t#H;pufDH9pHH9uHI!Dk H{I!AV1ɺfAUI1H5BL`SXID$P ZHxv>Ht;@HHHX[]A\A]A^D@[]A\A]A^ùLSiH5At1AUHATUHSHHH9H;stHH9H9kuCvCH[]A\A]f De H}I AULR1ATI1H5@YH^)H[]A\A]f; ] H}I, ATLnRSI1H5@rXZ1H[]A\A]AUATUSHHHLHL9t+HL~tDeHEAu^H[]A\A]L`H߉HLRUI1H5?XZ1H[]A\A]HxDh ;HH0HLQATI1AUH5?UpH 1OD1LjQH5d?<1DHGPHHH}SH=@HHtCPPP$H@HHHHt Hu[@Ly1ɺH5>1[øATIUSHdH%(H$1HHHID$PHHH9tvfDH{= HID$PHHH9uԋ4$t=HLuH$dH34%(uH[]A\1HLI9tY11 u&xLv%HL9t!HPHPHRu҃uHL9u߅tf.f.AWAVAUATUSH(HFPDd$pL$LhDD$CdLL$D$HHHL`Ay9IHD$LHHD$Y9IHHCD$I^InAF$D$E~ AF(HD$EfLIF0D$`AF8D$xAFP$$IA$AFT$A$AH$IyI~xyIyH|$htHt$hL=HCĀtHmX1tHMXH(L[]A\A]A^A_DHt$L(8IHLL4L61ɺ/H5o;1E1BDHU|$f 1E1LNH5!;=@L1ɺ%1H5:f.1ɺEE1LzH5:fLL3LN1ɺ)fSIщH@IHHHЋWPLNHHCHt[1L1ɺ$H5/:1[AWAVAUIATIHUSHLD$gE|$ I|$IUUL;1AVI2SH591AWH A9\$L|LD$H[M EXHI!MEXr@I$LhhLLÅtzH[]A\A]A^A_@I$Lhuz@붐I|$Aٺ61PAD$LLLH59P1XZfL1ɺI1H58ef.L:11ۺ>H58z0DU4vSHHHGH@PHx4HtEHCLuHkLH[]DH@HHHH@H{LcKXIH5711ff.ATUSHGPHL A$@u G[HLhŅthHLhC\u[]A\HX]ŅuHLIH5M71#뷐HH5%7ILL91HLgtHfL*9I11H56[]A\fD+L2JIDAVAULATIUSHALIuuHHt L;`HME1jHLjjjjUjjjHPHBHKXHLsHÅ][]A\A]A^DL`tHE1E1jHLjjjjUjjjJHPIH*HKX HL'sHCPHIHHxH[}HÅDLښ1ɺ 1H55#Hp~IH,L;`"hPh$hML$(1۹LH H54[]A\A]A^@hPh$D1L71ɺ H5w4O[]A\A]A^@ML$(L,H11۹ H584HHtH,fDAWAVAUATUSHH(HRH$pHt$`DD$HD$(H$DL$HD$8dH%(H$1HH$H|$('IHHOHIHIXHtHх%HSHH$xaA$HL$`D$ t$LHt |$ I $HL$#D|$Et DD$AvADD$D,$CD$@A9Dl$HD$@tDt$E<"D$D$HD$0D|$0H=?)IMw`IH6%LH.IH&HD$T$HM~EnID$@AF $`AF4$xAFtHsH{սAF$H|$1Ҿ: AF@D$ D$HE$hAHCD$D9t$LG1jH51L$t$ H.rL$t$ $hHAr$`DD$LDH|$"1ҋL$AF0AN,AVDCuAF$\$ AD \$ ELWG1ɺH51B;P1SA[[DfAL$P$xDD$H@@>"D$AF(>$D$AF0\$ D dEV0Et=H|$Av4EN01ɺPD$TLFH5]0P17AXAYD$ t$H|$0؅EA^t)D$0In`HI\p@HHmH9uHD$8H|$1Ҿ6IFXIFPHt#HHx E1E1j111jjH H|$1Ҿ7ȸAF<$AF1H|$`t HD$`EN$D9r AN( AN$vA)1DHD$hAF($AF$HD$`Ht HxHD$hI~HT$(LFHD$0HHM~XMMM'M9AMnPInL|$Lt$H($I\$M|$L9UDH{zHH{IzLHH%)MtOH5$ H), HsLH5 H5 H(Q HI9H5 H(QLt$ L0H5-H)Lx1ɺQ 1H5-H|$0l$t+AV AVAV(9sA~t En@E-"$H|$h$t5Ht$hHVFLHBtt HCL$lj$HH$Hp $AF\$td"D$MD|$u I}P|$ LDw IH5,1~EeEueAEAM1+$A}$AmD$1҉AE 1uAM,tAM0ډH|$0HH˥H9$H\$hDŽ$AMAUD$(D$HH$$AE $tHD$h9XL D$ |$ I}Pt $$t$H$MAH$IŐ+D$(D$IGXHD$8H$D$DŽ$t1H$HHQH fDHHHH9uH|$0HHhH9tK@HELuHXI9t'C 9Ct CH5HCHXI9uHE HhH9D$0uAU@DŽ$ЃA}@0D$LB1 H5\*4AG1+$Aw$ADA_ A_D$AwHAo0ALo,)AD$D$H|$0LT$@D\$HL$ uT$AOL B,LBH5)DL5{MDHL$(QP1R tHT$ ALBRAG H5e)PAGP1:HD\$PH[U AEL+LEH5)1AVLT$XE1ARDH$HH$AD$HH$H D$D$HD$ l$DT$HDt$pEHL$0HHhH9~H$Dd$LHD$@@HEHHD$PfA} AO(|$HD$8HHM_PLUH9tHsI92LMMILIDHsH9Mt4LT$XHI|$ 1jE11IjjH LT$X HH9\$8uLMM׋L$Ht@T$Lt8H$H$HLfHHtHH]H9HH9uHEHXH9D$PH$D$XH$KD$HL$$t=H$H9HHHfHH9X|H9uA|$EG$A9D$@u AG(D$XAuZA<$u@fD$ $;9D$ HE HhH9D$0AUDd$L($Ń9D$ sAUD dl$ $BT5A 9H|$ AT$D9 t~9tzEH$H$1LD7HHI9t6H9uHHHL LIDJDIHI9uʄt $A teDH$HA0H;|:H1 H9~s9uAw@˅t D9MAW(9A)A96A}y $AO AOΉt$| D$1Aw$D$t6H$QHHLT$HFfD09GHH9uT$D$AODƅt AWHu4IoHD$ HD\$IG`E1\$@Lt$ HD$8D$HEqAoHI$C,)AL$HAW0H8HH\$ KH{SA;T$ DT$XT$pL$Pl$LoDL$LHE+O T$xE+OL%>H5#RL$`QP1YsH LZH}HHIfDLd1ɺdH5T1@ID$IG uf.AwTs>HAAGTIEID$H@ 4 1=D@qM1L0H5fAXIo`,; H9 Ht$IG`AoXH9v1HD1AOhAՅt$9wzEg|Etq)Ht$)9s\ẢL$A)'1L<H5@H1ATL$A1AOhD)AOhAXAYnDL$Dd 'E)1LH5@H1ATL$A1cAOhD)AOhAZA[DHCXH& H'. H} |L 1H5A4AG4HDH@@tAWHtHKXAOh@D)A9H"LRIH51kfDAG8EwPEuKI(uDHD$ LPAH571 Y^?fDAXAG4xAPu I(AG4AOhfD\$%D\$1LH5@E11Ƀ臿D\$ID$E_T@ AD$L1At$8AIw`AGXv I` AxEohtE)H{XEEtIML$AA"u=E\$LEt1IqIyDƅDDE+Y1A1A͋D$D9cD$HDAGh(~0C\ AOh=DA9IT$B E_XA*v I`IE1E1I9u8f.E@E@@tD9uYAHI9oHPHRutt tՋH8I PL+W9A@AttI`uL 1H5諽fDHxHL8IH51aX@HCXH'yH$H@HHAoh@H;kH@@H蠏JL, H5ƼL@1H5蜼EL|$DH\$8E)AOhfDEH\$8D)IAͅt 1ACL5AOhHжHk ,Ht$ =B9D1AD9ΉH|$0HvEH|$0HD$HD$IUI!1MLH5E@H11HT$R vXZ@HjLAUIH5Z15A[[fDL1H5,L[1ɺZ8A8*f.H8zE1HAxA{AhD⋰:5AGhAA|IWxG$HAH9IL-H~ALEL5?AUA1ATLCH5,AVP1EO|H %f1AAxx4AAGhAGx5AA9AI}AGhH5I1ALRH5@H11AT]A]EghA^1AAx3AAGh@1ҋAx3AAGhuDII9xLZ1AhAx‰s3AAGh7I$LhIŰKDHLIH51a@ALJE_xEu ALJHH96AL-MALJL-<t L-(L5/@H;HPHLB W+JH{PAGhH|$HE1A7HsPHt$rfH8xHߋhT}xHlj3wAOh9HT$H:HI41M&LH58@H11UAohAYAZ9l$++l$AL1H5贶EEGXI`HA>H|$0ALHD$d1LL$L6H5f@118Mo`La15H5,LV1ɺN8L-L5(ALJfHx9H"HWHx YAHCXOIw`H|$0"LIH51[fDHLIH5K1!@H谯IHHhH|$0HH茘HT$HAGhHH9t$9rAwh‹t$DH|$0H艘D$DA;$tLA$ID$HHXALJv1LDH5}@11OAOhAD+l$]L11H54 @L1H5ܳHAɺD$ L\PfDH0LLIH51yp@fHLdIH5[11(@L, ,H5)H߉t$DD$ 6t$H@@DD$ E9GX3Hv6H^=LJ IH51藲fE1E1111AAx-AAGh@HAɺD$ L$PHD1Lt$HI>AGhIH1I7L H5 @H11AUر_AGhAAXEGX!LR1ɺH5蝱Ll$01ҾLqL4HcIw`Ij1MLH5n@11Ƀ@AGXLR1ɺ01H5>JHAɺD$ L-P*Dt$AWAVLAUIATUHSH(LH$HL$dH%(HD$1M9t2Ld$fIGLHHxH1諣u D$9LM?M9uMIM9t9Ld$DIFLHH@HxH1_u D$9LM6M9uэKH$Ht$1HHHIHL$dH3 %(uH([]A\A]A^A_ATUSHHtHtH[]A\fIH0HHt L`I$HtEH[]A\L1H5lDfAUIATIUHSHHHt'LLH9HCHt@HH[]A\A]fL1H5̮f.HH1L|O11H5蒮ATUHSHHtsUIH}HhtQH_hHtH{tHpL '[]A\fDLH&[]A\f.1HX`DHEL1H5LHH1ҭ[]A\ff.SDHOEHApHQpHHH9t%H;ptrHHH9tH9stdHHHH9uHFHQHL >LH5mH@HRɹPHLE1+^1_[DHx&HCDEtDH@H@h[fHHHHH9;[fDHxo0H@`[AWAVAUATUSHdH%(HD$1Ht/uSLLM1ɺ 1H5E1_Ht$dH34%(DAH[]A\A]A^A_fLw1HIvHI~P*.HQInhHtHH=ADžI^pMfpL- L9u4s@:IFPHu~HzHGhHL9tAHSHt DEEtIFPHuHHzu)/HH@`L9uI~PH4$AH($f.HxHADžwLK1ɺ$1H50HEH1MH5 LHHHB!pH1ЪYHS^=DIvHI~P1ɺ,HIFPLt^HAvH1ɺLV H51AmAYAZL-K1ɺ1H5kCHAvH1L E1H52A[[BfSHHtIH"H"H"Hy"Hm"H[L 1H5|f.AWIAVAUATIUHLSLHMhL$ dH%(H$1H5MEH%Ht!HHT$ HHHwHT$HH+IL11'H5賨H{IHH{HIFHHeD$ M~XAF`HXIFtIdžAFpAdžMt7Ao$AAoL$ANAoT$ AV Ao\$0A^0ID$@IF@LHG11LTKIEH@H@HHtLLЅHCH@@YtHHHIFhH$dH3 %(LHĸ[]A\A]A^A_LAH1ɺ1H5W.fD$IHL HH5?HDº#E1P1ZYYLG1ɺ;H5H{LE1"&DLG1ɺ*1H5触fLiG1ɺ>H5聦1E1LH5yQ@LG1ɺAH5L)C@LF1ɺ-H5$7AWAVAUATAUSHH(HGPT$HHD$s)HHCPHxHD$H H|$L54zOt$HD$E1E1DIdMO$HE1HDщAWAVjjjH|$8 |H0IEAW$AW HՉЅt AEL)‹9Mtz|$usDAo A)EW$ExHN(IHLMO$EW$APLtIx1HwHxkDAh Ip1HCP(HxIHttHx-H|$L0XL!E1ɺH5\9HD$HD$H([]A\A]A^A_@D$tAG AO$L1H5ޣHD$HLKH1ULH5覣ZYHD$fLzH5t?ff.@SH#et[DHCPHKX@HLKHLC H5=1 XZ[fSHdu[DHCPHcXHLKHL H51譢XZ[f1efDAWHAVHAUATUSH8HOXH|$Hljt$T$HL$(HD$D$$D$ L|$AG[tSItILI_HbHLDH@ H5LHHS1A]LA^/eHD$\$1L8DL9t$(IHHEA9^$mIFhHt@IVHL H5LJHpH1aI~hA[A\dIHt # zIHt DT$EIFH@ IHxIF@^tfLvIIH@@HL*u+D$LkA1ɺ1c tIFH@H%s4IHx< IHt# ZMMLIFH@ tHIH@A9F$t1AF$I~nL1ɺRIH51躟LE~$MFAvLIx t 1A@YE(fE1AE;fLDDLl#uL@1ɺH5<L?1ɺ\1H5 E1H8D[]A\A]A^A_A+@1ADAAŅ^fDAV$D)AV$uAVPD)AVPMvD)HD$|$ t D$D$$D$H|$+t$/gH|$!Htt$ ,P$L$HL$HAPH9XHL$HxHGH@H@HHtHt$ЅbHtH HD$(tFHD$L@PIXHt1IIH90HHPHJXfApDIFHxL(HIFH@,AzEE)~$EdfHEL1VH5ԜAXAYIFH@H%OH|$V HPHRHуL$ tDx(1EL$ D$$2HPHJXHH9uI8BqHD$H@PHXD$L<1ɺ;fHL$PPP$f.D$L<1ɺaH51˛D\$1ɺ"D$Lz<H5螛D\$1ɺ%D$LM<H5qD\$r1ɺAD$L <H5gDD\$EAV$D)AV$HH'HCPHqX(HǀXD$L;1ɺD1ɺ<D$L;H5辚D\$H|HD$LY;1ɺ}DD$L=;1ɺw1ɺ9D$L;H5a>D\$?1ɺ,D$L:H54D\$D$L:1ɺ3D$L:1ɺtD$HD$H@PHXPLIH51虙D\$ff.@1ff.@AUH5ATUSHHHGPDH8eVHIEuDALD1HHH!CX耝ŅtRH[]A\A]HXŅuL91ɺ1H5豘1Lo91ɺH5臘H[]A\A]f.L991ɺ1H5w1MSUSHHC\tF9t^HpHVu6HL +Nt H{PE1H_Ő9tHHߺ[]3HuHuHt\@H`tHLIH51]H1[]@MfHHCXuSff.SH#uHÅt[fH[31L71ɺHH5迖[ff.AWAVAAUATIHUSHHL$dH%(H$1#HkPIH,HUADžDEHCXH!H"H& H'H.H/H$HHD$@HLLHCXH4H%H-H4Mt EU(EHD$HtH1HHc)HLL9zHl$LIH HH9RHCHxG^tuHCHx`LIALv511H5茔H$dH3 %(D H[]A\A]A^A_HLIH5[11H谮Ld1IH5#1h@HxLd8IH510@H@LIH51E1膓HLL%IH5{1Q@HЭLL+IH5C1@H蘭LIIH5 1P@HHHHCXHDHT$LIHl$HQHCXH4GH-sL H)TH߉D$]AŅH1ɿHL fLH54H@pH1AXHAYH|$QHkHFHD$HtWHoADžuCH|$A&IMLH511gH%"HLGHSHHK HLL>UD$uyD$D tpEHH 0H@L@HH\$ 1HH×E,0ILDH511譐ADHwQHCXH[Ht @[HCXHHLHhHD$7HGL$Ht$DLfHCX1ɺNE1L0H5RH iHCXUH)OPH@H01ɺE1LK0H5of.HsH1H5n1L )L1^_H+HCHL HPLH51ZYXHl1ɿLXIH51踎H`THLHLIH5ֱLKIEHIH@AELAEPAE$HɈHtHPHR H$HCXH|$lH|$AdIMLH511襍HD$oIT$ H=-Ht H=HrM, 1LH5Z2H赧lLiIpL-1ɺ1H5ZHHD$HT$HhHHD$HT$Ht$DL"H|$LbIL9-1ɺRH5y1E1LH߆HHx=1ɺE1L,H5&rHL 2H@H@HHkqLI&HJLf?IH51蓋1ɺE1LH,H5lHL.1ɺIH5e1;Hx=L+1ɺH|$蘥L8vIU,HtL]I1L+1ɺH5變H}HHtH}HhH[LF+1ɺLCHH eP\LI1ɺE1L*H5?1LH5d{LTIH51Ɖ5AWAVAUIATAUSHHXdH%(HD$H1uHHXHHC[HDH%JADžRHLH诣L1ɺbIH5%1HIMDLHp!ADžfDuHdVHtPLDHL)ADž.AHL$HdH3 %(DHX[]A\A]A^A_fHHADžuHCXH%@1H-slHXHCXH(s]EuXHKPHHH9tAHHPHrXtHPHrXHH9uf.1DHLADHUHADž:HLOHߡLIH5R1E1%HGHCPE11HL$ AHH8AqDL$ EcDD$8EUHt$H耦ADž D$P$EHGHHILH=VH1IH5m1CfDLFDHLL#1ɺ}1H5 E1hHxH=H17IVHIn HMPH;HL j(ZYIVHH;HHM@Lt1ɺ1H5|LN1ɺ1H5d|dL(1ɺH5c@|@HŅL1ɺ1H50|LH5{ff.f1uDAVAUATAUHHH@SHHЋtkuVLjDr΋WPÅ*UPDHÅrE1DLDH.|Å@[]A\A]A^ËUPHEÅuL1ɺ1H5z@HBWPLhDpÅt\UPDHÅDLDH#{ÅiLR1ɺ1H5hzHL)1ɺ1H5g?zf.L1ɺ1H57zf.L1ɺ1H5yf.L1ɺ 1H5״yf.Li1ɺ1H5y_f.AW+LAVAUATUSH(HG@4_LHLgDAH5DGTLO0ID$PO$DT$W DPDD$Dw8H8LL$L$ T$6HLjDT$,HARAUDD$8APE1jAWSjAVLL$`L$\T$X{vHPIHEL1ۅu P;]LsHHLu1ɺBE1L/H5vSxH(L[]A\A]A^A_ÐHDžHLHL1H5&1E1wL1<H5w{ff.AWAAVIAUIATUDSHHJIIu I$8t9LR1H5}UwE1HD[]A\A]A^A_IEPH5H8]4I9D$tLIHtA$9Al$LLADyy!t-I$MH IHBHL DHHL rXH9uD9rifH;HA9tLH1MLzwu։D$ L;1ɺH5{1QvDL$ IMXAL1ɺ1H54 vE1@HA PL1H5uXE1Zxf.D$ L1ɺEfAWHG`AVAUATUSH(Ho`Ht$T$L$HD$H9IAH|$DHH{u;pPHC@ut$HHHDkLAt$HDwrAD$E1ut@AE9|$veDCt=HHHHHPWuuӉD$L1ɺH5ȯ1tDT$H(D[]A\A]A^A_DsPHmH;l$HD$HHXH@PHxHGH@H@HHtHt$ЅAH|$p H|$D$蝎HID$$LlH5P1sZYDT$8H|$WHH5ڮAVIL1s^E1_D$LU1ɺLB1ɺ1H5XsE1D$L1ɺfAWAVAAUATUHSHHHLfPH|$HdH%(HD$81HFHHD$(HD$ AH@ HCXuH4ADžHT$HLlADžumHCX@@MEHHkHH@HhHEAHL$8dH3 %(DHH[]A\A]A^A_@D$A$L 5ULHH5LD1E1qZY@LKH1L9H5qYLKH1LQH5q)L@KtL&L51ɺ1H5sKqfDHH#HHH@H@ H@XHtHKP1HT$H9Ѕt D$cHxL IH51pZ@HD$HHx藧HD$(HHT$ H5=,H腥ADžtfHD$(HHCH/EHd"HADžL 1ɺ+1H5H pL1ɺ"1H5ofL E1H5odfDH0HKfff.ATIUHSH1HH~PHdH%(H$1't HH}PH5HhHtkH1HLÅt-H$dH3 %(uaHĐ[]A\L1ɺD1H5nDL1ۺ=H5ܩneff.fbfR2fAWH1AVAUATUSH8Ht$1mL&1ɺHiIHD$MH@PHHH|$(H9H|$(HWH9T$LHH|$ L9MMDAwLE1MEMu]AD9CDL<@IIL8uHL$H9HuIyEqPEA hGE|$EtDd$ML|$MEE@II9t!S 9w C$ 9wHI9uI|$E誇HLAUI1H5lXZL 1ɺ(1H5lH81[]A\A]A^A_f9D9A)DMDd$MAqLAD9MMM?L;|$ |HD$MH@PHt$(HH>H|$(H9H8[]A\A]A^A_D$I|$ADtwC$XEMLd$D|$IJ| _I~HSUSIL5AWH51AUkH DLQ 1ɺ1H5gkwfAW1AVAUATIUSHH@H|$(HL$1LD$ LvHLJHH59<kM$I$HD$8AXAYI9D$ AWLKE1fDAE9oL2DH@IL4L8uH9Xu΋pHHHHM@ A}L H|$HM0HH!H9IuPBT1AOP991HDLqID$PH5sH85'HEHL$ ELH|$ HD$ HxHL`H|$HAxD$ E9oLfDM?L9|$(D$ tL"vA2HLKHLPOH5_15i^E1_H8D[]A\A]A^A_VML$HLYH5(PRasHQAG P1hH0E1IHLKHLHBD0PmHLKHLVt$H5QP1hH E1GD$ L< 11fH5zRhDT$ LkH5I&hE1LsH5gE1L1ɺ}H5gDT$ ff.AWAVAUIATIUHSHHVPHHH9t>IHsH9t MLHLADžHUPHHH9uHADžI$I9uHL9txH{HgX迂ADžuL1ɺ1H5fHD[]A\A]A^A_DL1ɺ1H5סfDALi1ɺ1H5fff.fAVIAUIATIUHSHHH9u CHH9t8HxXt1LH55 f[1]A\A]A^fHIHyHLHH9t!Hp0HhH!L Hp0HH9uH I#FX[H EXHI!FXAIH]AdžA\IdžA]A^AVL1ɺAUATUHSHH(dH%(HD$ 1wHLNHH5'eAYHAZ_IHLhL9t[HsHLMH1E1H5۟L6dY^HL$dH3 %(DZH []A\A]A^LLA|$LI$8cH9hH9tAą11HHAąIEPH5eH8'!HAH1HZhAąHmHH5HWHAH(~HEL$LL`P1H5E1gcXZH}LHHLASfHsHLMHL֣1H5$c_AXJfHx}HI$LPD EfK} L PPDfDHE1}LIH51^bfL1ɺ1H5W/b{L1ɺ1H51 bUHMLc(HHUHt[HI9u(1ɺE1LH5ܜaL}1ɺ1H5aIEHHLH,$H5)HD$oAąL-1ɺ'1H5kCayXfAWIAVMAUATIUSHHHNHHT$Ll$0HrLdH%(H$1g2HSXLCP1LBHHHnH5ALTHnHCPH1ɺTML5H5q1L`YL^H5k1HHdLHHHD$HL$L9uM6L;t$tnIVI|$Ht$2uL 1aH5Ӛ_H$dH3%(HH[]A\A]A^A_@H{P/9-H{PnRHL{]LL9l$t%LfDIuL0MmL;l$uHLMHsH1L~H51^_11AXHHbH5*LHHE11jHHjjjjQjjjLL$hR\HPIHE111HH`_pHLHKPHHHAH@@Yu2L%#Ml$(LLSUIM9uEDHHHHCh뷐L1ɺH5٘11]L111GH5z]DHCHHT$ H5HHD$ HEHHD$(JL 1ɺ1H5I!]t@L1OH5\GL1ɺ1H5\fL1ɺ1H5Ǘ\f.LY1ɺDHCPHMLqY1H5k1A\XZHCPfLLH5511 \\HCPkLLHCPHMLtiRf.AWAVAUATUSHH8T$L$dH%(HD$(1FY IHH8>Mt$`Il$`D|$L9uXM6AI9tEDHIHAv@P9sAu HAEPM6AI9uHCPH  HH8H[HtHH@HD$HpHHCPHx蓑Ll1ɺIHGHL1LAD1HD$LCPHPXHD$ H*DD$Ht$ HߺuHCPH5}H8JHD$H Ml$`I96t$H|$`HD$H HD$HA E1H$P jjjjjQjjjHt$pH|$hzWHPIHJAD$E1ufAE9t$qDDLHLHHPYuщD$L1ɺH5V1,YDT$,DL1dH5$XE1HL$(dH3 %(D3H8[]A\A]A^A_HXs^LIH5˓1XE1@H sHLAWIpH51cXZE1Y`fH߉D$rHH5WID$ LyP1X^_DT$HD$ LHHD$MmPPHD$ T$I9HCPHKXHxHGH@H@HHt HЅAD$LM1ɺ2HqL8IL1ɺH5Y1/WE1.L1ɺH5+WE1L1ɺH5VE1HaqHLID$ P9MD$Lo1ɺTAWAVIAUIATMUSLHhH|$PHHt$HL$@kHD$H H{dLM1H5RP1LAvHMMHVIuHI~PAXAYH HHD$0SHD$LHHD$(L|$XL9Ll$8Ld$HIALE1MEuAE;wLDL$@IIL8uH@IPHpHz@H9~@uIP HH9tDt$ MMHI;^ IJD(D`AGPkATCŃ9rA9wIwFtAOLA9r~9vH|$D)Aw ͮuL1ɺ.H5ݏTL1ɺV1H5T1Hh[]A\A]A^A_D)H|$T$AG $S $T$VL1ɺ'H5X5TvMDt$ AE;wLf.MM?L9|$(>L|$XLLl$8Ld$HLt$Ht$0IFPHH$IMD$HD$HL;|$XZH$LAOL1Iu3A9_L#H $HH@IHЃ8uH@HPHz@HQH;z@uPHA H(H9tMDuAA9A9AOPT$0L$(imHD$ H$H@Hx@iHL"L$0I1QT$@RHt$8VH5ڍAVURH0t$uxMtsI$I9t,H|$HT$H;xuDH9PHL9uHD$PHx蛆HH|$HHxLD$fDH@IHЋHBH5muHhDpIEPH8"H1HD$8IGHHpHH@PHAGPHt$0ATHL$(T$ Ht$0LĒI1VHL$0H5QT$01RAV{QAOPHE1AAWLjjjjQjjjL$L$L OHPHH1LHn6H|$HHIUPAGPE1AM LHILQ>L1ɺH5ҋPAG AW$HL H5R{PHD$ pHMMH1oPH 1Hh[]A\A]A^A_f.HmH9MDuAAD9w9 fDL1ɺ1H5'OKf.D$L1ɺH5O @L1ɺ1H5OfLY1ɺ1H5oOf.LM?L;|$XDH~r1ɺLPLt$1H5<L'AvHMMH OIuHI~PXZHuL1ɺR7HHD$06HD$HHD$X1LlH5ʼnN1fDAWAVAUATUSHH $HHD$$D$dH%(H$81H$HD$$D$D D HADžHCPH8;ADžGHCPLKHHkH0L1H@Ht$0HHt$TNHCPHt$1H8sIH'HoADž Ϸ'E>EHCP1ҾJH8H߅gL1ɺIH5H1MfHgLIH5 1LH$8dH3 %(DHH[]A\A]A^A_DH8gLIH51LHgLܾIH5s1ILc@fL 1ɺIH5A1LHLfHHCPLMI H8hjL1UIH51K_AX耰1fD1LL$LAHsX+ADLKHL{H5j1E1=KWEHL$Hl$HHBH9ILFeIHCPLH8gUL1ATIH51MI JY^o@HD$ HD$(M1Hl$ DHT$ HD$(HHT$ L9HL9v LH)HD$(A~T1H8t@8c>1L ͋L PHPH5 1IXZnLHLd$(Hl$ TdH謳L HLLDHATUSH51E1yIH LL$LDHcL1ɺIH5N1$IHCPj1ɋ$ALH8RD$HT$(FOA[]ADžqsLHccH軲L HLDHLG1SH5HAYAZD HCPLH8 eHIbHIL ׉HLLDHATUSb?fUHAWAVAAUATISHHdH%(HE1QI$AI9uzHL9t`HH{ ADžuL޻1#H5GHUdH3%(DuHe[A\A]A^A_]@HCH@PHHEtEDHHHHHHH)HH9tHH$H9u%~H\$M4$HH]M9rIE1M6AM9tWI~A_|HMDuIvHEL nXH8ƯADžPIFM6AHH!HXM9uM,$M9uMmM9fI}j)EjEuu)EH ADžuL1ɺF1H5)FHEM,$H8M9tQE1 @MmM9t?D9vHuDEv<uIu谯HEMmH8M9u3L$1ɺVH5tELY 1H5lA>EfHt#HtH'L1ɺ21H5E1DNA<DI}E1L_LEiIQH51DHEH8A}H)HLtHEAH8yE@HEI~^L;IH551 DA;AWIAVAAUATUSHhH|$HT$ DD$DL$0dH%(H$X1kH5gHIGPH8HD$HgHCSLt$HHHH [D$$E1Hl$PLKdILhMt-LHtHPB tHD$$LhSLNlID9wKID$4E1HD$8L|$(D|$0NdLojD$ 1ELt$H$QDD$ DH|$AYAZ1ɺD$LDH5}hBDT$H$XdH3 %(DLHh[]A\A]A^A_jLDDAt$XD$LD$(H|$r_AXLd$(Lt$HCH@t 'EID9kLDT$$L|$(EDKLE1Zf.HHRHHI$HA$P$PP9kLLH@IL`LHuLUH5|1@E1DLjA  D$0DŽ$Et$8A$HHBKTmsLE1LdjDAt$XLD$(LH|$qZY1LID$PHT$8I$Hx:2D$4FDD$$S$L$ ʉS$0SPt$ LA;|$$AaIoX*MoPuLe.LLƴ1ɺK1H5zl?sL1t"HH@HHxF9kLwIwX*DT$$L1ɺH54z?E1L|$(D$HLճML$HAwHH5y>A[[DT$a1t$CPD$$uHCH@H D$4D$$D$4HCL$4H@L$$H `Lg JD$L1ɺ5H5Wy1->DT$Ld$@D$LҶCLH4@HCHH@PHx6rDT$HHKLE1tnK`LCP1L4H{LD$ 1HDL8HEt AE9 HKHAoLD$1LH|y>rL1ɺt1H53rLd$@7HQLIH5r16fL1ɺ1H5q6{f.Ht$H>cAHxD$,5E+CZ!HD$\lqHP H5=qIL1 6HPH=H1PAƅuL@1ɺ*1H5~iV.HHCXHT$1HHL1ɺ11H5'i-f.AWAVAUATUSHH $HHHoPHT$HIdH%(H$81HEHD$ HHD$BE|$8IEIT$(HE1HxHD$H'H?HXHuAHRHCPHHD$(ҰIHCX  @ DE% HCXH" H!L Xj,L1H5g,Ly1ɺ1H5g,H$8dH3 %(DHH[]A\A]A^A_HHCXH EL$hH%Eu8I|$pu0tIAD$0IT$pE1ID$(AD$xDXAo$Aod$H$Aol$ Aot$0Ao|$@)$I$)$Ao\$PAod$`)$IAol$p)$Ao$)$Ao$)$)$)$)$)$H$ iIID$(H$AD$0$HELtIH5 f1*L1ɺH5e1E1*)HAHCXEuH@ H Ao $H%AoT$HI$IL$xAD$hAo\$ )$Aod$0Aol$@)$Aot$PAo|$`AoD$pH$ Ao$HSP)$Ao$)$)$L:)$)$)$)$)$@HLH!HAvLHAA1AcWEHCXH%Ht$LHߩ@<[D$L Ai@B9Ei'BD(AdD9DME|$h$EXIH$I?HTIFH@@C\t A|$4H0HCXHHHHBLDIH53c1 (T@HLHxHALH]AA1WEL>1ɺQf.Lɡ1H5b|'@o@ID$`HE\$PEtwHCXH%r)H&r"H'r@uHxH(rH7sDHAI1ML]H5b@11&AD$PET$XEwHD$(H@H@@XHpIHdCZA|$4HT$H|$L\\ADžA|$45M LTIHHT$H$H\ADžA|$4\ $N AD$PM'AT$huM D$E HD$@\ E1A|$4u C[  Ht$H|$ M1H4ADž1 M L DH(E H|$ P( HT$H$L)ADžnD$E%HT$H|$LADžpA$tDH|$JADžGH7XHD$@\ A|$4@HA2?H蚊1IcH5_L@11p$At$Pt A|$4EHD$H@PH8 Ht$H|$ H|$>sL gIH5_1E1#ZfA~L[H]>LHbHH5^SILg1#^_HPY HCX@dHqH)YLH=L%xIH5L^1"#mDL LW8@AD$h$A[IE1AD$hffDHX=LԝIH5]1"@L1ҾL1ҾAAA1EL1ɺH5p]1A2@"L)1H5<]"E|$hfDA HWHcD$LTfL 1H5[ (HL$(HQHRBXA 蔆1LCH5[@11m AL$PAD$XID$` fDEL$TEHD$(H@H@@X{1LH5%[@11AD$TAfL1ɺ>H5Z@HD$PXH@H@ H@XHtHKP1HT$PH9Ѕt D$PLi1H5|ZTL1ɺ.H5LZ)I@MHH9D$t,1LH5 Z@11ED$PEu A|$4LkPL|$PfE11ALHI})D$P)D$`D$p2A|$PD$P=AD$LA|$4AT$hfAL$@ED$DE1H޿ADžfDEL>1ɺfL1ɺ61H5WT/f.HCPH$0LKHHHHt$(HL1H@HCPHt$(1H8WHD$0HnHD$ Ht$0H'HHD$ Ht$0H'HAT$hDH|$ )։T$1nLIDLY1ɺJ1H5Qof.L)1ɺ1H5gQ?f.H0L$IH5+Q1L@H0L4IH5P1@L1ɺB1H5P?f.H0LIH5P1a@H9HL$(H9HPHLr1lH5-PLε1ɺ1H5 P/LL$(1E1LzH5OH|$0DLa1ɺQ1H5OwfAL$@AT$hE1HED$DADž AH.H=H1^1LLtIoX+AF(tIoX,IHP IGXH-H$5HD$Ht @\8LH~AV4H<$LMDL$EAVDLL҃+ IH@H* T H|$t AG] M A2H<$Ln2IGPH8rAM AuIgXH|$pH|$EFx1LOAHHAV4Ht$H<$nH|$hLa"IH1DLdH5>XZ@AHEN|I}vLLlH5K>#fDL$HULG% ɹLDH5=1ZYfDL uAF4L1ɺ8!E1LKH5=of.MALAAvxILD$(L$$T$ t$ׅL$$T$ ILD$(t$HK=L̢1ɺx!H5=L1ɺ!;DH|$V(HL$AFxH9mID$ lfDALifLI1ɺ@ 1H5W</IFf jHAN|H;E1H AIA+AF| A~qbAF-IL1ɺ H5;LH(1HL$D$E1HAF4, SJH<$Li1LL!IH5.;1IE1IzHLAPENpm 1H5:AYAZ?LXHHoH@H@_L2HHD$HD$HHHD$Ht @\8E111LHN_Ht$HDH|$E11L1ɺ!E1LH59WL!1H59H;H5!蹻LR1ɺ IHf.L@T9spE1DDL$HHDH1HHA9It@d1 H5&9LG@H11AWDL$EY^L3D$AE\ tLpHC H<$LfL FHn IHFfD1ɺT!E1L*H5q8NfL11A@LH#1ɺo!E1L՝H58@L8;%1ɺ E1LH57EfLXH@H@ IGXEDL0AVxLPT!AVH|$ HD$ !LV@[\H|$ AVxAH?; H<$H5c'L1ɺ!IHSHL$IF/H<$LD1@ƃAv4L( LGIdLa~_ fLX L!1ɺ`!DLL:1ɺ"IH5>51IFD$HLHD$@HD$LIHD$TAFDD$\t$Xt$Xt$Xt$X+H A>H<L <LF=b"H54LD1tIGPH8H<$LDcL"LKILA1ɺ!1H5/4fH*]EEH;H5BL1ɺ%!IH2HL$AFfD1ɺ!E1LZH53~fH|$Ht$LgHH AMHMEEvxL${L$MMDDHG3gHITUx1LC"H52Hu{HHL`b{HLS{HZgLH8LX` H|$Ld$`IwHHMLm H<$L1LI萇L1ɺ"H5,2 @MHILI nHQAG]VH<$L`BL>Lp"I|LN(H1L*{x AQH51b_AXf.H LW{IEEQH*H,H<$LIGX,_IwX,fL1yALP@tyAPDDL 91ɺ!1H50f.LQ LxHL)1ɺ=!1H5g0?f.'H<$LB^ LL~!IH5011ɺ E1LH5/5HMNX LzE1H5/vXZLL(1ɺ @L1ɺ!H5L/)H~ LxMN` LzyIQLL[|R0!LLHHaLu1ɺ"1H5.1ɺ E1L@H5.dL L+"IH5Z.10Lly =AV4H<$L5L L6T"IH5-1WH,H<$LIGX[L}G"H5-YLQ(Ņu1H<$L[L/(D$Il$L]L1ɺ2"H59-H'Ht$H<$]aHt$H<$=^`1LL1ɺ"1H5,mD1ɺ"E1LRH5,vL L wI5H<$L4[fI|$H!HLqmIHaxSPAW1H5v[D$TPT$TH dGI\$HkA$`I$IVXH1H-A$HA$LWI$PtcLpeI|$HSHLlIH8wSPH5v1AWD$TPT$TH dyI$XtcLeI|$HHL5lIHvSPH5u1AWD$TPT$TH d ID$@_+LdI|$HsHLkIHvSPAW1H5;uD$TPT$TH dLhHtH@@L dI|$HHiL@kIHtSPH5t1AW*D$TPT$TH depHMNH1AWH5utLjT$DBD$DY^dDLXcI|$H;HmLjIH^tSPH5t1AWuD$TPT$TH d\LbI|$HHL#jIH*tSuPAW1H5s D$TPT$TH dLbI|$HkHLiIHjSPH57s1AWD$TPT$TH dHt AF\HIFXuHID$HPX$ HA|$LuyI$8ulHxZHtHLTI|$HHL[IHSPH5fe1AWD$TPT$TH d~1M9$M9$M9$M9$h1M9$AtM9t$XM9$IL$YE9t_HAt$ L aRAT$$RVqHMNHP1H5~dT$dBD$dH0dIL$HHH9uuHH9fI9u1M9$HmH;l$MIL9udA IH9GhtDMNH,L`AQwH1H5c6T$DBD$D_AXdM$$I9ID$DHxEuKHt IH9p`tID$MNHLm`4H@AQpHyCLRRI|$HD$(3HT$(H5cIH8[LWR0P1nD$DPT$D^_dNI$HDAT$ AD$$HLQaLIHAvHH5bпP1RT$TBD$TH dFHQHAD$$HLt^AL$ MNHAQRPQR[L1QI|$HHLdXIHXUPH5a1AWND$TPT$TH d#5LPI|$HHLWIHXSPH5xa1AWD$TPT$TH dI\$HkLXPI|$H;HLWIHXSPAWLPI|$HHLNWIHiaUPH5`1AW8D$TPT$TH dE$EMI$tcLOI|$HzHLVIHdSPH5F`1AWD$TPT$TH dI|$htcL,OI|$HHL_VIHzdSPH5_1AWID$TPT$TH d5I|$`7LNI|$HHLUIHdSPAW1H5h_D$TPT$TH dLUNI|$H8HLUIHcSPH5_1AWrD$TPT$TH dPYLMI|$HHL UIHbSPAWOLMI|$HHLTIHWSPH5_^1AWD$TPT$TH dJLHMI|$H+HL{TIHYWSPH5]1AWeD$TPT$TH dQIFXLLI|$HHLTIHG^SPH5]1AWD$TPT$TH dH;LeLI|$HHHLSIHTSPAW"L(LI|$H HL[SIH1^SPAWLKI|$HHLSIH`SPH5\1AWD$TPT$TH dMDEtEAWLOHjH5J\1L8XT$DBD$DY^dE1MNH1LaH5\rT$4BD$4dCHIHKH54SREP1蝷D$DPT$DAZA[dGI$HDPL BIT$HLJLJHPAD$LPj@LAI|$HSIH[UPLG1H5RD$DPT$DZYdAD$8LlAI|$A\$LHJLSGIPHUUSPH5R1芶D$TH ; 0A|$<L@I|$A\$Ls@I|$A\$LHQLRFIPH.TUH5QSP1葵D$TPT$TH d3L @I|$A\$HHLEIPH|;USP1H5P*D$TPT$TH dL?I|$A\$HHLEIPH;USP@Lh?I|$HKH*LFIHhUSPH5P1AW腴D$TPT$TH dlL?I|$HH(L3FIHTSPH5O1AWD$TPT$TH dnI$uYLw>I|$HZSuIHnQH52OPLD1蜳D$DPT$D^_dEAD$8#PtgL >I|$A\$8HHyLCIHQUSH5NP1#D$TPT$TH dA$;AD$<E\$@EQED$DEID$@_ uA|$HvbLW=I|$A\$HH5L4CIH8QUH5NSP1uD$TPT$TH dID$H8HPXLIHH5IP1D$DPT$DAXAYdHt$4L1L8I|$A\$8HbLc>IHKASH54IUSP1衭D$TPT$TH dCL8I|$HSIHKH5HPL=1AD$DPT$D^_dL7I|$HSIHJPLi=1H5lHD$DPT$D[]dLX7I|$H;HL>IH MS%PAWIL7I|$HHLN>IHSPAW1H5DQD$TPT$TH d8L3I|$HHL:IHHSPAWL3I|$HuHL:IH>SPAWLU3I|$H8H L:IH&>SPH5D1AWrD$TPT$TH d^ID$hHPXDMNH1L/BcH5C&D$4ML`ASH5CT$4BD$4dL+HtHHtxLt\MNHM1L@H5$C薧T$4BD$4deInXIL@WZH8uL9pu艞fPMNH1VL>H5BT$DBD$DAZA[dL1I|$HtUQIHHSPL81H5>BAW賦D$TPT$TH dID$H@0L%1I|$HHWLX8IHGSPH5A1AWBD$TPT$TH d.ID$H@ff.AWAVIAUAATUSHc)HH'h D9HxGLH0D@(HH$HpPPCTPPCPPCLPC8PRHPIHHIFPHHxgyDHSsL)B7A)D$PD)E1CPAl$$K$K AL$ DHM$H,@HHIAutKPJE1DHRL辥I$HMNHL?D(PHHD(pHAUAWC PH5?1fH0AD;{LCHLiI~PeÅFH[]A\A]A^A_E1Lj?H5?LD1ɺ1H5f?1֣@HBsPELLL$PHx)p?LL$IAHI$HD(PHHD(T$H@Hx@.HMNHL>T$RPAUAWC PfInHH-{L=UIH5>1AU XZ 1LC1ɺ1H5]>Ϣf.HAvHEH5->L =1葢Y^Yf.LI=1H5=\^L<=H5=.0LB1ɺH5= LB1ɺH5o=Ht G[tDuuATLgpUHSH_pL9thHCt.Hxu!HL9u[]A\Ð[]A\f.1ff.AWAVAUIATIUHSHHHt/HxXHXpHt HՅHtLHՅMMM9#IHt LՅIHt LՅIHt LՅ\IHt LՅqIhHt LՅIHt LՅAGL1ۅuuDA9_LvgH@IHЃ8uHxLՅuԉD$ L@1ɺsH5SA1迟DL$ HD[]A\A]A^A_M?M9L^tmIIŘL9u XHL9tMH{LՅuD$ L @1ɺzrL @1ɺa1H5@#E1aAVD$ L?1ɺj'D$ L?1ɺhD$ L?1ɺlD$ L?1ɺfD$ Ly?1ɺnD$ Lb?1ɺpfDAULATIUSHHdH%(HD$1D$L9t]@UL1ۅuED9]Lv8H@HHЃ8uH@Hx'tIL$X9]LwHmL9uHT$H5LÅt5D$uHL$dH3 %(u9H[]A\A]IL$XLa>1ɺ1H5 ?w谔ATIUSH HWXdH%(HD$1tHL$dH3 %(uYH []A\HHH4$HHWXH5HLd$tLHHSXHHHSXfDAW AVAUAATIUHHw SHLwPH},I9t9HAML$HH5>1E1LjA_`^_M$I$HD$L9AGL1ۅuA9_LH@IHЃ8uH@H} L`LI9tML"HmAUI1L@H5B=E1譛ZYA9_LwDM?L;|$RHD[]A\A]A^A_AWE1AVAAUATIU1SH菍IDI9vl@A֍HHPuyC<4vbHE1ATH5<E1AL}@L&Y^IŐDI9wHD[]A\A]A^A_fDH Hs:u[@tUHE1ATLN@E1AH5 <|L褌IXZzf.:DA\ff.AWAAVA)AAUIATUSHHT$ H $dH%(HD$81YY IHLH\$ L@fAoE9H<$‰ItDDDI H߾ 1H,H Hڋ H!%tHADHJHDщ@LHH) ?Lh?H5:LLE1/ H\$8dH3%(LHH[]A\A]A^A_fH5\rL\ L, L0? PH591AVDL$`XZzfL91H59:@L>1H59 L>$@UHSHm HHt-Hh@HuHiHH[]Li>1H59tfHtHVH61DSHGXu[H%HH5HGXÅuL71ɺ1H58ff.AWAVAUIATIUHSHH D$ MIAL9tA M?I9t=ILH u1ɺE1L/7H57SM?I9uIH9tH}1HmH9uD$ uLHD[]A\A]A^A_f.I}1 AƅtQMIAL96I}1 u1ɺE1L{6H5,7蟕Lf61ɺ1H57|[ATIHUSHt5A$Lx2L61ɺ1H561[]A\1L<1ɺH56[]A\UHSHHHH׏H H<H)1苛 tH[]1LR51H56oH1҉[]@H = tA=t5=t)A1ɿLI;H551 Hff.@ATUSHHHHHG`1Ҿ*HxGSL>;HH5%5HH HHD11HIw2  AI9H{@Ht8HC`1Ҿ)HxvWHC`1Ҿ+HxZWuvH{@ݩH1PL1L;H54XZ[]A\fILF:11H5N4輒HHC`Hs@H@H舡Hs@IHtTH1IHtGH7I1PL:1ATH53LMLHs@_AXHC`H@H4H{@IHH1IH辨1ɿIPH5t3Lu:1ATבYLH{@^DALv911H5.3L虑L*DHC`Hs@H@HOIH&H1IHH{@ I1ɺPL(91ATH52L AYAZLSHH@Hu&Hu]HtHC`1Ҿ-Hx UuPH{@菧H 1PL1L9H542袐XZ[fDHHC`Hs@H@H@HHHff.ATIHUHSÅuTH1UH=?M$@L%胉XH=k?Z%uQ[]A\D1I1L9H5=1谏[]A\f1L ?L8H51u[]A\ff.AUATIUHSHH@HmHIbA~E)DH9wAHHÅHLQÅtSH[]A\A]f1Lo81ۺ*H5L0躎H[]A\A]D1Lj82H50脎H[]A\A]1L7/1ɺ/H5/OH[]A\A]fAWAVAUIATIUSHHLvHLH IHIII9I@f.HkHupHt L t[LL HEpHtcHCHx@VHRL7ATI 1H5.iHCL XZHL9uH[]A\A]A^A_H{WLS7MIH5.1H1[]A\A]A^A_ML6BH5e.ӌ1}ff.AUIATIUHSHdH%(HD$1HT$H7t@D$9Er/ A;wNHL$dH3 %(u~H[]A\A]ÐEL-1ɺH5-1%L1֢MPD$ Ld6H5u-P1XZpfAUATLUSHHdH%(HD$1D$L9tOHLl$ DHL9t8HCLHHx@uHL$dH3 %(uH[]A\A]fD|ff.ATUSHGPHHHHIAXtcItDHx HHSPHHzH]Ņ[]A\DH\[]A\LHwHLs5TH5,11|Y^[]A\HCPsHMLb5[DHCPsH`ML,H5+1XZVff.fATUSHGHH@@XtgIt@H HH{HH\Ņ[]A\DH_[[]A\L11L4nH5*S[]A\@HM1uH5*Lt4Y^H1MzLu4H5l*߈XZIATIUSHHzLHHH9yH݅HDH[]A\UIISHHH=V*tAAXt$wxH[]tAI9P t5AL411۹H5w)vAL>4@AL31H53)1蟇H[]fDAL.311۹H5(gfT$ WT$ 1Lj3H5(@A1ɺ1):@ATIUSHH6{ L3tfCL3tNID$`@Xt[]A\@HSHCHu{HCHt~H=vL311H5(p[]A\fL''11ɺH5'=[]A\fDHt HvH{HCBoDHHǰH9u'HH9tHPHzy1ff.fUHSHHH9u )HH9t H{tH[]H1[]ff.@AUHATIU1HSHHHu%HH H)H9reHH1[H]A\A]HH)H蚡I1M6H5g&L2@11ȄHH H)H9sLQHLICHLH5AU?L1UI1H5%kXZ1H[]A\A]ff.AUATUSDHAL]LEIOcM>AʉAŅtNaI<$HSAU~1SIL?21H5N%較XZHD[]A\A]@I<$HHH5 %SIL11{iY^DH[]A\A]fA$6M$LQ1E1pH5$TfDHH9tHL$ $L$ L0E1hH5Q$迂f.u]H1HHtNH)H?H#H{1Iٺ\H5#L@11QA$I<$HH[]A\A]E1LdE1uH5#HD[]A\A]X1AL/H5[#Ɂ @ATIUHSHH9t6fDHCH@hHt HH9HGHL9uHt H[]A\Ð1[H]A\fDSHH1HGHHLJ(HH)8HC HCHCHC HC(HC0HC8CHHC@HHCXHCPHǃHǃHǃHǃY HM HA H5 H) H H H[ @SHH?HHt6HHH9t#HJH;A@uDHJH9A@t HH9u1H[HH9tH;pu @H9pt HH9u1fDHHH9tH;pu H9ptHH9u1fATUHSHH9t%IHH9tH{L tH[]A\1H[]A\fDATI/UHLSrHHHPLEHH9u-DHH9t HCLHxHvuH[]A\@1H[]A\ff.HHVH3GhH3WpH upHFHVH3GxH3H uXHHH9tEH LLVHH9t0HBLH(L@ M1M1M uLFLNL3@0L3H8M u1DHHtH@HDAVIAUI/ATL(HULDLSpI$HPHLEI9u?HL9t0HkLHEHxHtuMtI[H]A\A]A^@1Mt[H]IA\A]A^ff.ATIUHSHHtLH Ht[]A\f.11LHH1HtHtf.HHH9t#HBH;p@uDHBH9p@t HH9u1fHHǰH9tfP 9wP$9w HH9u1HHǰH9HDÐSHHdH%(HD$1D$HtbHtPLuHT$dH3%(uiH[H8uH@Ht$H@Hx@,D$9sf.1L**$H5|{1rHHǰH9HDÐATIUSHH_ HG H9t0@HCH@@HtHLЉŅt%I|$HHG H9uԽ[]A\1L1ɺH5az[]A\AWHAVAUATIUSHH(8AE$A9E$EA$uHCIT$H@H9BI$I$HL$HD$H9 HLHD$HD$H@HhHHD$I9I M?M9IGHHpH$quI/E1H5;L)A$yY^H(D[]A\A]A^A_fDA$A9Lz(A$H517y_AXfHD$HHD$H;D$I$M$I9uafDHmL9NH}HtH}HHL(IS:DHL'P H5 1A$qxH 1E1LL 'H52xDHM$L' 1H5wXZSLpHAeAD9lE$A$L'SHHH9uPHmH9t?H}LktH}I$vHL^'ISC3Aff.fSt+HHH9t@HPHHbXH9u1H5cÅt[1L1ɺH59v[UHSHHdH%(HD$1pD$tbHt:HLKH>L&D$ H5P1tH=ATUHSHE1uuLD[]A\@EauL1L# H5q Ait@Hh~u1A LL&H5" iD[]A\DHH?A@FNf.HHfDH>HHUHSHHHV`tZ1ҾH34Ht8HX Hu(-uH{?t H`tH[HtuH1[]DH[]@1Df.AUIATIH= USH軚 HtVPHH HHtfH{ HhAELcC H{0 HH[]A\A]fL1ɺ1H5q 1gLy1H5F gH̚ f.HGhH9t3USHHtHHHtHPHHRRhH]hH[]Ðff.@UHSHHH H}HsHH[]sAWILAVIAUATUHH5tSHӺ:HpLgL$1dH%(HD$`1HGHD$1fAX(AYL9 HH{pIdADž|$ ]H $HC`H;At_Hp8ILSH51E1.fY^HT$XdH3%(DHh[]A\A]A^A_fDLHADž IL˜ HCpHAoFhLHCxAoNxAHH$ǃHxHGPKHL0HgLd$@HLJHIATL1H5eXZfDHILLV@@HIALZx@I=LH5%1E1d]fHIspLC0L)1ɺI1H5E1H.tD؉At1Hl$ uHA$11DL$LH5SCXZI|$Lx >Lv 1ɺ1H51CDATUHS u(H]AH9u fDHH9tHHtAD[]A\fDAUATUSHH8HIąHAA9HyHH1H5UMP1LBYH^tIHH[]A\A]Ð;+HtwHGfDL! 1ɺH59BH1[]A\A]@MLt1H5BH1[]A\A]@MLf.HTY+HXHA1YH߉ATL1UIH5 1pAHXZXHYMLaH5#A1ff.AVAUIATIUSv I$L5I9u(Qf.LLv t\HL9t+HkH2HLHZv t6L9#uLL9uպH55L5v td[L]A\A]A^w L~1H5<@[1]A\A]A^ùL}H5@L}1H5{?HtgSHGPHHx@HHt HHt[@H8ZHLSI1H5|?XHZ[D1ff.fHHtdH=6HָtFH=5Ht+H=5Hf.1ff.fHHt HgHf.1ff.fAWIAVAUATUSHHdH%(H$1H0fAPHD$)D$0)D$@)D$PAGf ' A跰 HD$PHIMI9uU@HL9tIH{迯uHsM1LH5F=HXZL9uIML9HD$`E1H$@AME9PLsIL9tKHHtHH1RLH5$=MLs]1XI~pLY4H|$P L Ht[H{H4$@xH{IUL1PLL$ H5'11K LT$LLH蚢M6L;t$(MfHLLD$ HT$LHD$8H6H(H9u)HmH;l$8L11ɺ9 MIH51HLLLuL1L1ɺ< IH5o1L1Lr1ɺN IH5A1L`1LA IH5 1yHHT$LL41 H5ɻ7?LE1 H5 5L| H5sL1LC H5HH{HmL%| HG H9u )fDH{HmHG H9E uHEH@8HtHHЅuM1ɺ H5ֺ1GL 1ɺ#1H5$1L 1ɺ H5H{Ho HG H9tL% H{HmHG H9VE uHEH@8HtHHЅuM1ɺ H51D)H߉ULA 1ɺ&1H5WL 1ɺ 1H5ù1FHE1LwH5H{AXLAY;L L 1ɺ)1H5\L 1ɺ1H56ff.fAWAVAUI1ATUSHTI}1ҾILcMIMH+L9uuDHEHL9tdHH{HGHP`L9LH)L9vXjtTHCL!1H2H5pH@LHH1HEL9uAHD[]A\A]A^A_ÉD$ HCH.MLH5 H@pH1rXZD\$ fAWHAVAUE1ATE1UHSHLHD$I9fAGL1ۅuA9_LH@IHЃ8uH@LpHEPHIv@H%I~@},HAI;0H1AVI1H5LH^_A9_LrDM?L;|$BEtEueEH1[]A\A]A^A_fD+HAI/H1ɺKAVI1LH5ZYH{/LWRIH5X1H[]A\A]A^A_H8/LW1ɺWIH51H[]A\A]A^A_HHHtHH H1ff.fAWAVAULATUSHhHdH%(HD$X1L9HD$IIHD$fIH?HH9I~@ILšIHID$Hx*0H1ɺ UIL1H5aAAHZIYI;fHL9ID$LsHhILHUHIF@A H)H1ɿPM1H5NL I~@^_ALRIH?HH9L&&DK@1PC HLHA,$H|${Hs`HL- JI|$ HChL'IH;|$L|$MIIMLL;|$ttI舾HH|$LHHtHR HMLP QH51f L]X輂 MILL;|$uL|$HLHHuuLM9tiH-!I}臒uKIEHp@Ht>H18IHt(H(' L7_ MmM9uHLM9OE1D$H$Uf.+UMPLr11H5שEIFHXZM6M9tI~@H贓uƄ$IFHx@HGtpUMLP11H5GAM6A[XM9uD l$t HrHکR HLI9uf.HmL9cH}1#uHELLHHH51 HD$PH|$h(LXH|$1ɺLH1jD%PH|$L1ɃMLgH5tHL$P1ۉ9DML11nH5Ƨ4H|$L觰HH$(dH3%(HH8[]A\A]A^A_H$HT$H|$LHH$H$S~L$I9`L|$(H$Hl$MAHD$ M?I9MoI}0tA}<uL:H{HDŽ$MuPH}`LD$L1ɺIH$eDH8AE8A9H1ɺPH5dL]1Y^H}L9 WEL|$(DL$ImLI9t)@} LIHHmH9uEDT$tE8H|$8K(LHD$XL$HHT$`EN(LRHt$`VL$XH5Q1P1H LD$HHDŽ$LfDLl$8H9LX)H8IFH@HtTHL$uFHMHEHDL1ɺH5P1UZAXAYD$@H_PML1UH51^_DML611H5~]MN(IE0I97H1ɿPLw1H56XZfL1ɺ1H5f.A$A$ID$LH@PhL 11 H5ǣ5L-l H|$1ɺL, D$D` Lt$H\$LLHLLHH$HMHy PLͥ1pH5AXAYLHT$H|$@H|$L[L1ɺ1H5Ģ2DMLItH5fHI9u_HmL9KH}-uHE L|LHHpE1L1ɺ1H5of.HCHHt/HIٹPL1H5+_AXHC@Ht.HIٺPH5L1Y^HD$hH1fHML1UDL 1ɺH5.@H|$SHn(fHD$Ht$Hx}IH1J H|$11 LL$LpH|$L[HD$HRL H|$1ɺL D$DML1H5fH舋HD$@Lt$AHD$HH|$nHf1HL$HH @ HT$  L 1ɺ1H5KIELHx@TH1ɺHAVIL=H51jAZA[IELHx@ HI1IAVOLLH5 DML|$(EAF8HMN01ɿLPH5H1L$A[A\E1ImLI9DH訽A4oChoKxƄ$H)$)$L9t1DH}H@t谅uHEH@@H`HmL9uH$'HHH9uHH9HJA`uH=&. HD$XHh HL9H\$0Ld$XL|$8Ll$(IŐIEHx HD$ HHQH(H9EE1F Ls0 L1LH0 IAHmH9L}AGauEtH5L0 uL 1ɺ7 H5aH\$0L|$8H|$X- L 11 H51HD$* ]L8 1ɺ'1H5I1@D$L 1ɺH5M L`1H5|H L 1ɺH5KH|$/1!vMLҜL1ɺ1LH5ZE+H5L- L. D$ E1HD$`HD$HHHD$HH9Ll$xEDML1EuF;]L:H@HHЃ8uH@H@Lx@MAGauEu= L, L@1LH3- )EfDH5L - uL 1ɺY H5H\$0L|$8Pf.DT$ E"H|$L1ɺM IH5h1Dt$ L1H58lWHD$A L< 1ɺ1H5R:D$DPt&CaHD$uDl$ExDd$tEXHD$H{. H{@t2L1ɺT1H5VH{@[HC@H{Ht2L1ɺ[1H5H{H"HCHHS8HCHsH|$.HC@H.L fH52 DL 1ɺH5 CH|$z^1 1ɺMLH5QL|$(E1ɺMLH5L|$(L1ɺ1H5ML|$(^ML|$(듿L11H5A+L$ImLI9Lה 1ɺ"H5|@L 1ɺ: H5SH\$0L|$8HCHHt/HIٹkPLH51A[]HC@HNHIٹmPLH5ڔ1FAYAZD$p<ZLuHD$ L1H5sL 1ɺH5TL 1ɺ3 H50H\$0L|$8L] 1ɺH5u~L9 1ɺB H5ޓH\$0L|$8GxL 1ɺ\ H5H\$0L|$8JLHL\e1H5qA^XV$1LLuH5)$L` 1ɺH5xLH|$1JHkH?1LLH5LL1H5ysL 1ɺU H5PH\$0L|$8H 1LH5LY^1Lה1ɺH5WHD$LLڔ11H5LLPoLx1ɺN1H5`L 1ɺH57D71LLpH5w81L~H5U=L 1ɺ 1H5/a1L4H5>LǏ 1ɺd H5lH\$0L|$8H dH%(HD$1D$ jLL$NZYHT$dH3%(uHfAVAUIHATUSHH9t(HhIH;U@u?HhH9U@t.HH9u1L 1ɺH51jHLL9tQDH{迯t7H{H{t'I|$l% Ht/HSHLHPf HL9u[]A\A]A^fDLa 1ɺH5y[1]A\A]A^f.@1fUHAVAUIATSHHHdH%(HE1g AƸEu'H]dH3%(He[A\A]A^]DHHHBHHHHH)HH9tHH$H9u%t H)HLLd$1ILIEI9tLHHHHHJL9uHpDLDHt.AVAUATUSHH $H IHLNHdH%(H$1Hl$HIHrRiMH@HLt$H$HFPL1 H߅ DH1ɺUILFH5b1YL^1HL*IH(H訑AŅtqL褜1HL"LALdH$dH3%(DH []A\A]A^f.HCPHDLH5LsH1XZ;L DIH5b1E1ZfDILDE1 H5,R)DILDoff.@UHAWAVAAUATIHSHHH8D4D0dH%(HE13d B1H HL膈HMDHHHBHHHHH)HH9tHH$H9u%JHD$1HHH H@HKHH#HHǾ1 E&EH DDhAFIDuHDH(5H81HDlID4L;(LCP1H ?I$HAE)EEuHCPH5 H8菥jI $Dj4ID0H8ZYjI<$L1IH51fDHKXDEHDH HpÅ(H}dH3<%(QHe[A\A]A^A_]H0kH8LH5FL 1ɺcH511#kfDH)HLf.HLDIH51I<$OLIH5t1ML1kH5FlL) 1ɺZAWAVAUATUSHHIHH_ ADžMIHD$L9AELI8E1H@LuHXL9u/uDIFH@@HtHK@Ht H@8H9A8tM6L9tHIvHptAE;eLsDH@IHЃ8tMmL;l$^AHD[]A\A]A^A_fDUHHE1S1HdH%(HD$1HGPHL$H8t*1ہ|$HT$dH3%(u>H[]@HVLjrIH5{1AVAUATUSHHLI1HLumII9u_HI9tPIEPHSHHHxAąu1LH5ؽ[D]A\A]A^fA[]DA\A]A^ff.SHHPHCPuH8HLÅt"[ÐH8H޺[鿒1LO 1ɺH5Ag[AWAVIAUIATUHSHHHHGPH߉T$ 1L ַML9uRfI}PǼt I}P u~L1H5E1sDM?L9tIWI|$HuD$ L1H5]DT$ "@D$ u0LHKAHD[]A\A]A^A_LhttLt(LL LuD$ Lނ 1ɺWDLD$ L(IH51DT$ iD$ L 1ɺH5w1DT$ 7D$ LU 1ɺff.AWAVIHAUIATAULSHH8DL$VH9tIHL$IH51E1H8D[]A\A]A^A_DHtEED$L$uL}LL9u@M?L9|HCPIWLHxXu܉D$6LH581\DL$CfL 1ɺ)1H5 /A@MLo=HL,IthHfHHD$(D$HD$D$D$؈D$t$(t$(t$(t$(H HLKHLhIL*LeHL9tIt$HM$$L9uA H{P߸tH{P"L 1ɺ=1H5øE1L<BH5LeLL9tfDIt$LkM$$L9uD$tHbG*H{P1tH{PtL}1zH58E1!L/H5E1D$L~ 11?H5DL$LVH5L<JH5cHLsGD$jLH{PH|E1AD$tLHLb]IH51DLOH5Mff.AVIAUIATAH2rUHSHdH%(H$1HHk xgMHD@13HH1HLt`H$dH3%(HHĐ[]A\A]A^fDIL11۹;H5̵DL| 1ɺE1H5zf.L| 1ɺB1H5yJDUHAWEAVIAUIATESHH(M}dH%(HE1<H^H8HKHHH5HM7LxHMHtoH)HHPHHH)HHH9tHH$H9ut H)HL4H|$HHHLwH@DH{PLIHm}v:HDH9wxjMLE1AWALL7ZYM1ALLLH]dH3%(LHe[A\A]A^A_]L)HA~L1ɺIH51=DH@H5 HxHHKHLHILYE1亮H55[.fDLE1亨H5+fDL91H5ֲ2fSHtBHGPHHH8BH߅u9\Lͺ1ɺIH51[sAÅuLVy 1ɺ1H5Flf.HWX1tƀtHHHf.GYt>S[HH8t 1[DHxtH[H@fD1DSH5HHdH%(HD$1D$HtsH@ H@XHHHT$1ЉÅt(\$HL$dH3 %(H[DL)x 1ɺ]1H5?DLx 1ɺW1H5DLw 1ɺZ1H5ɰi%DAUATUSHGYuH[]A\A]f.HSZIH@@ uAmLCY uŅt11ۉL$@IIL8tA;]LrޅtH[]A\A]ÐHxu fDIJ| GUHSHHHHtbH@@tHH[]fDH}oH{1HaHL!UI1H5XZ멐H}'L÷IH5L1psff.҉USH։HH9w\H9vUҹ)HEuEH;1I麬LH5Ʈ@11H[]DsLT1ɺIH51H[]fDAWEAVAAUIATAUSH(HGPT$ 1LD$Hz.L3u 1ɺH!H50HHqHI}PHD$AHDH AIIEPAL\$tzAUE1ɹjI}PL1AWt$(PjDD$D$(AtED$HD);D$s4I$L|(LtL;tufDD$ED$+D$(D$0Hl$@H9 D$0Lt$ A9D$LwMI$HHJT*HPt9 AT$PLDOA9\$LL,@I$IJ|(HgXIFPHHx HuLnd H5E1L|$ LAG[H|$ D$rLIH51軿DT$+@LrH5h1茿E1HT$XdH3%(DHh[]A\A]A^A_Ë$@Dl$EtAT$9T$0tD$D$(>f1ɺD$L_ H5ҘDT$jD$0AD$L9D\$0EDT$,E1E1EDD$4EH\$@H9Ll$ !@H{/%HH9HsLu1ɺD$L$_ H5HDT$1ɺD$L^ H5DT$H\$ E1HLҘ1ɺIH51ݽLHIHH!CX\$MIFXĀL19ALIL1ɺIH561ZEMLE:Lt$Lt$ L|$Ld$PIHRL<J|9HgXILHJT9IT$5 A9]LIFPHHx IHuL] 1ɺH51詼E1H|$ LH|$ LI|$MH|$ knH#|$4H\$@H9uHH9H{Ku1ɺD$L\ H5ɕDT$af.LID$D$(D$0L\ 1ɺ H|$ >I$LxIgXLL2H|$ LIVDd$4EtH|$ HH|$ QuHHL$ H!AXH|$ >\$,IątMu HIHL$ AY 1HHH9HH0 HH9u1ɺD$Lr[ H5k薺DT$MtLMtL7HD$ H@PH8ѧuL[ 1ɺ$H5.t$4H\$@H9uwfDHH9tiH{u1ɺ*D$LZ H5عDT$ED$LZ 1ɺH51詹DT$LL|$0`HD$8HtL$(H|$ H1ɺIPDL$81L/H5/ZAYLt$L|$Ld$LL[4D$LY 1ɺ D$LY 1ɺ D$LY 1ɺ1D$LsY 1ɺD$L\Y 1ɺ.LD$L#ID$1LH55DT$D$LX 1ɺ!XH|$ LI|$HiHL$ E1HHHyPLH?WtFHLLuf.H1*LH5r|蘢1HÐH+tPH=>tDH~}t9HA1L8H5|>1Hf.DUHSHHGH@HtFHHHHHHDH FXHHH[]T@[,Lo%IH5K1蔡H1[]ff.ATUHSHHtHHCXu9H}LL8IH51)[1]A\fIHH袚tHHH!CXI$[HDž]A\ff.@ATUSHGHH@HtpHIH@I@LD11莡ŅtxHCHSLH @H HDH BXS[]A\@*1LuIJ1H5ʔ[]A\1L@ 1ɺQH5[]A\AWAVIAUIATUSHHGHOH@0+HIMHSXHQXH H$HQXMtHL Ņ_Mt;Hs1HFPHxHAI~Ls`HpH HL贗ŅMt*M9tHL萗ŅLH߽faH[]A\A]A^A_DH0HHQXAE^+HCHhX>DHHa ]@HFPHe1H5LLqH1PY^cfL ? 1ɺ1H5Ԓ4f.L> 1ɺ}1H5f.L> 1ɺ1H5t违f.Ly> 1ɺ1H5D菝f.AWAVAUATUHSHHdH%(HD$1HHE@ G\  E1HL#2L1-H5LM$$H HH9DKAAuDD9Ku(1E1LۉH5?芜;H}E1LxIH51MHL$dH3 %(DS H[]A\A]A^A_H{H;}蝶 L IH51HA8 HUHBPHH}`HtHpE1HphAƅxHt+E1ҾHiAƅoHHєAƅH}XHtH赔AƅH}HHHL+H9u*HIUHLI9IHsHF@tH;~XuMtFHGPHv1HxHHULHRPHzHAƅ HsH}AƅHCH}H@X_HГAƅ]L: 1ɺ 1H5ɎH}XLpD$L IHLk ID$HLP HHHEH{pHP@ooHoP oX0HS@HPHKHSHHPPHS HSPHCX[0 M|$HuXAI_H%HT$LXHdLHLHEHxPLH Md$MLHEHHAH!PXTHHpX4HDžJH}E1HH#HH5SIL61MY^fDH}`8H HEH@P@H]`HEHHH0LHLJL8 1ɺ1H5f豗H}8LIH581聗D$tHEXHǀLL L(8 1ɺ1H5>L8 1ɺ31H5ҋE1DHHHH9udDLH%AƅHuMt"HFPLLHx.AƅHuHH HH9BHLhHFP1HxHu1ɺaE1L87 H5 \ L 7 1ɺH58L6 1ɺC1H5NJL6 1ɺ61H5L6 1ɺ1H5{ƕH}MLQIH5M1薕L_6 1ɺ1H5*uH}LXIH51ET$HEXHǀL5 1ɺ?1H5L5 1ɺH5H}gLkIH5g1谔LL Li5 1ɺ1H54LF5 1ɺX1H5\ HvX$AHDžHEXHE`L4 1ɺH5 L4 1ɺd1H5L4 1ɺ<1H5unL4 1ɺH5L蜓1ɺQE1LQ4 H5%u#L94 1ɺT1H5OL4 1ɺH5ۇ+uL3 1ɺh1H5HT QHEff.ATUSHwHHH9H1HPHzG^uHu=HHH9uHHHFXtHCH@Ht^H[]A\۬H{IϬH}HìATLmSI11H5XHZ[]A\H腬H{HyLxIHPUH1PL4IH5P1虑9@HF u@t 釩yff.<AWAVAUATIUSHHGXH%RH-D$@ID$PLE1L(E1HLxIIǰI9ufDHL9tPH8uH@HxIH藟IMtMHML9uMDt$LT$I w M9 LLLILHͪLT$LHLʬHLbAWI1UH5SH H[]A\A]A^A_D$IH̞I@LLIIf.L8LT$@TL9H[]A\A]A^A_LLL~IH511H[]A\A]A^A_Df蛩L}IH511LLrLHWLHlLpTQUSIL+~H5:1舎XLZ.LT$DPTAWAVAUATUSHHDD$DdH%(H$1E@F@ALl$0HOHHIILLZZHELD1Ҕ HCPH5FH8KHH3膜t"HE H@XHtHKP11H9ЅjDLAjIHٺ@^_1$$LCPL1IH11HH&jHDIjDL$1LŽZY3AD$@HԁHSXHH HDHCPH8+HH$HlHHI>MfHL/LLdAu\LC- 1ɺPH5 [EfDHئL'|IH5؀1!E1H$dH3%(DH[]A\A]A^A_f{L{IDHXL{1ɺ IH5[1褋CLa, 1ɺ1H5,wE1QD$L-, 1ɺ H51CDT$fL+ 1ɺ9H5̙Ht(H{PdtH{P?f.L)1ZH5a謊D$LM(L,tH5+1tDT$Lf.L)+ 1ɺMH5~A+@H{PD$ cDT$ H{PDT$ ?DT$ HCPHkX,HH8DT$ gfDT$ H)D$HD$ D$(D$,t$(t$(jj;H DT$ OHCPHsX,HDT$ H8kDT$ HDT$-LzIL * 1ɺ61H5} f.DT$L) 1ɺL) 1ɺHH5}ш@L) 1ɺ=H5Y}詈@Li) 1ɺC1H54}iHLx!IH5}1K5HDT$ɢLx'IH5|1HCPHsX,HH8DT$}&fDAUATIι7UHSHdH%(H$1HIHH$t$pH5D$H$$HD$$IH$H$HEPD$(H8D$4D$DDD$tD$HDŽ$$DDH$Ht_H}PL{HHHEP1LHH8tWH$dH3%(HH[]A\A]HLn' 11zH59{脆fLI' 1ɺ1H5{_DL!' 1ɺ1H5z7[m}ff.fAWI1MAVIHDAUIHATUSHI0LHH9HMHLlLIQHuLIRHAT1IمAWH5Cz @Lv11|HuA[[DLHD$@tH[]A\A]A^A_DHD$@DEH]HfDJD1HHHH9sMueHD$@tHL菡HuLI耡I1MLvH5iy@H11AW訄XZrHL5HuLI&LH ATH5ySILu1Q^1_HLՠHuLIƠI1ML[uH5x@H11AWAXAYD1L$ 1ɺ$H5tx迃H1[]A\A]A^A_ff.AVAUATUSHHXdH%(H$1HCXH(DH(HIHLJXHCXHHsHL豒 _LxH1LHHL|IAT1MAVLuj@H5mw11趂H}XHZ1LsÅ111HH$dH3 %(HĐ[]A\A]A^DH[LtIH5v11'DH訜OL'tIfLH5WH HLqt1ۺdH5qv輁1Ly" 1ɺm1H5Dv菁xDATUSHHLgPdH%(H$1I$XHt H9LŅHHKH1HvH HLKH1ɺ;UL^t1H5uۀI<$X1ZHH ŅH߽HkX(I$XH$dH3%(HĐ[]A\fDLKHLs117H5tN@L! 1ɺ21H5t'DL 1ɺ=1H5tW5wDAU7IATUHSHdH%(H$1IHLHHH}$HDH5Ll$I$D$D$(D$4D$DD$pH$HDŽ$D$DŽ$H$H$Z<H$HL1ɺ1LrH5s~LHfHHH}Ht:HBH$dH3 %(HH[]A\A]fD麩1LZrH5sn~@HL. 11H5rD~fL  1ɺ1H5r~`f.L 1ɺ1H5r}0%uDATI1USHHHXHHuqHLI9ILGMPXtEA9vDH9DH?L9uӅSH[]A\8H9GHWHt$ HH0t$ A9sHtCL1)LSDK8jHAU`RATVL։@H ÅkL 1ɺ1H5Rq|JDƅEH!H LpIH5p1E|H;1ɺHÅL 1ɺ1H5p|L)p1ɺ1H5p{f.LHHiL 1ɺ1H5Pp{H6fHGH@`HtSHH9vH[f.f.SH30u[DAVAUIATIUS 0teA$u]ID$L0I.LL9uHHEHII;l$t/HLLQ/tA4$LA4I|$H$ fID$HH+H9u@fDHEHI;l$t,HHL.tA4$HH3HEI;l$uA4$L3[]A\A]A^@HG`HtHp8HHx 1DUHSHHH~@觐HtHHH[] HHZooNHOHtfHHxHHHxU8DHvPHt > fD1DHvXHt  fD1DHG`oFxoHO@HG@HHH量H@HH@dH%(HD$1H%H$u1HL$dH3 %(HuHoDuHf.HSHHHtHt H[+[HH@DH@H@H@DDHHw@1mHtHH@@1HÐHHw@1dH%(HD$1D$%H1HtHT$H5?D$HL$dH3 %(uHnff.HpSHHuHSpH[ff.@1HpÐHHff.fH`tESH|t,HC`1@Yt Hs@1H9HtHA‰[1҉H#LG0IH5j1uDAUATUHSHHHTH}@AH߾A8 HHtxEuStRaHHൃxCH%HmCHH[]A\A]DdE-uOˆ@L1H5itfHHw@1HtHHL@@1HÐHdH%(HD$1H$Ht3HH5=H$HtHL$dH3 %(uHD1kff.@HHw@1MHu1HÐHHd@1tHff.@AT1USHH0Hw@dH%(HD$(1HIHChH߉,$HP H0HT$HDHD$HT$t(HD$HH9tG4$H,HH;\$u-HHz9t^HH5L4<HL$(dH3 %(umH0[]A\fD1L 1ɺwH5gr1HLgH5gL1r1iff.fSHw@1HHuHHt5H{@Ht,0LgIH5Mg1Ir1[DH[7=AVA1IAUEATIUHպS1VH5iAPLpgqHEZYH9tpB|+9HH9tVP9wHу9rBt+AVA1LPgQR)VH5FiqH 1[]A\A]A^L諥 Ht/XHHDh$ []A\A]A^fD@L끹Lh/H5hq1AUIATIUHSHg LHHku)I9,$tH9w AEH[]A\A]H1[]A\A]ÐAWAVAUATIUSHXdH%(HD$H1HFHx@HtIIAL ŅtKL4f11H5g5pH\$HdH3%(nHX[]A\A]A^A_I}'IEtLI}Lf1ɺHD$VLL$IE94L3L9t-I}IFHW@H9P@u@IFH9P@tyM6L9u(L豣 IHdAoELAAoMANIE IF { HZHHD$ HD$HLIF I}"Mv HD$MHD$4HD$ HD$@HD$HD$HdH%(HD$1H$HtxIHAAID$HHEH@PHxAtmID$1C.HH@PHx"tNH$HtmHCLc D{(DID$H@PD)Ht$dH34%(HusH[]A\A]A^A_L 1ɺ1H5=[1bHHL\AVI1H5[bXZzYATUSHHPHdH%(HD$H1H{ HG`L1Ҿ3Hx&u)HL$HdH3 %(HP[]A\DH{H{Hw@HHG`H@H2qHtHCHp@H@`H@H1qHwHSHs HC)FPHIuIHz@cxALT[P1H5YATyaXZHKLH HHy@HH ÅL 1ɺ1H5WYa@H@HÅu*L 1ɺ1H5Y`x@ILNZ11H5X`F[HH5XSILY11j`Y^Wff.USHHHG HwHPPH@H@P9tqWHx)1Ņt+HCH޽H3 HunH[]D1L 1ɺCH5W_H[]fD)HG G(H[]zf.Hx tyLY11H5WS_`fD_H1[H2LYSI1H5MW_XZHH[]fFGH> ff.AUATUSHL'L9I1H-"Yf.MT$ MI:I9tpIt$LHI9tILfDHH9t6Hx uPO9ADCPO9HGщD)A9FH9uH?I9uM$$M9mH[]A\A]ID$Hx@tI1ɺwIH5V1]M$$M9%H1ۉ[]A\A]@AWHAVHAUATUSHXHH|$HHL$(HD$@D$D$<D$4D$8H9fDHD$(D$81D$0H@LHD$HHD$ L9E1DMAD@ H@LXHAEEgEwL$H|$DD$ D$SDD$I1APL\$LTH5TASATAVAU\AGH09t7HAPLT1H5T]\A^XD$IG HH[HHHڃ:t:1LTH5HT \IG D$HHL9zt01LnTH5T[D$IG @PEOD9t9HLLTPH5S1[A\A]D$EODL$0DM?L;|$ t8Dl$IG A_(HQE1L;NfEOM?DL;|$ uȋD$4l$<+D$0D$4HD$9t7HAPLUH5"S1ZA[[D$HD$t$09t8HAPLUH5R1ZAYAZD$HD$(HHD$(H;D$@$HD$HL$89t7HAɿPL`U1H5nR5Z_AXD$HD$Ht$49t6HAPH52RL?U1YY^D$HD$HL$<9t6HAɺPL-U1H5QYXZD$D$HX[]A\A]A^A_DAWAVIHAUIATUHSHH8DD$dH%(HD$(1HD$ \IHC`@XHCpHH$+Ht$ HADžHt$ HtPH9s |$H9V1MULU1ɿH5PXXZHl$ HHM1VLU1H5PXHl$0A[A_HH9vH9hH{`HLHDHGP0MtI MLP11H56PWH<$ADždI} H> HtAHLH<$u LV1.L y1MẳLIPH5OA@11IW1MsLRH5YO1E1WHL$(dH3 %(DYH8[]A\A]A^A_ HSHL#TSI0H5N1VAYAZL| 1ɺ1H5NE1Vtf.E1My1LqH5NIV.@HLrU1H5_NPMLR1VY^WLrHM1PLQ1H5 NUAXAYDT$Ht$ ELPrHLIBrLLH=QH1f.H1Mt$LTH5oM1UXZE1E1LTH5=MTf.HHH=HLURIU7ML TH5LT_fDHLAWAVAUATUSH(t$P(HD$!@L&HD$HH@HD$HpD$D$tHgDL$1L L{H5GF1H([]A\A]A^A_DHD$H|$D$AD+o(t$H|$i1HD$E1LH|$DIH[DD;l$s.A^$LLI.A裿 EtM&ID;|$rH|$HHH9t(11ɅuHt$N(P P$H(HH9uHt$D$D$9FLD$HL$H@HHH@HD$HLY 1ɺmNHD$@(D$H|$DKtHD$LfDL 1ɺ1H5FEH(1[]A\A]A^A_fDL 1ɺdƸ2L 1ɺff.USHHrHZHH?_HLJUI1H5jEDH1[]f.f.UAHISHHOHdH%(H$1HcH\$H`HHI1J HOH}PHT$ HHEPu>HxHz HHH$dH3 %(HHĨ[]fT$ L ~Ho\SH5XDLtIҿLD11[CY^ILI1۹H5D)C^@H1]LHIH5C1B$f.LC1H5CB9fAWAVAUL,vATIIUSHHH$J\(HHL$HJl(\HI\HI\AW1H5'CAVILvH1A -BHsX"HHuX!XZ跞H诞LH;tLH;u91L 1ɺK H5BA1H[]A\A]A^A_I$H5DHB(I$B($HCHHtCH5CHHEHHtNH$H(HD$HH[]A\A]A^A_L 1ɺQ H5AA1DfL 1ɺT H5A@1f.AWAVAUATIUHSHHt H2HXLL=)WHHIHLDID$PHHxt IHfHI1LH HH1[]A\A]A^A_ff.AVIAUATUHSmHH@@{Lt6LOEH5k?1E1>[D]A\A]A^HEP0Hxr IH2HHxI}ޚHHHx7AąHLLض HHxHwX"蒚HIuLH@IE(觶 HHHptAąA[HH!EX]DA\A]A^fHE1%LCIH5G>1^=[D]A\A]A^f1L 1ɺH5>/=[D]A\A]A^L/>uf.L 1ɺ1H5=<[f.AWAAVAUIATIUSHHoPt$ HI9t DID$ HWH1ɿIHexPH5@=1L*USL9JI49ZAߋSL1tƒA9CLwD9"ADE1E1D|-tuELDA)D΃A4A9t'H4RItF[uD9uىA4A9uD9tAG7E9Au1L>dH5F7_6H(1[]A\A]A^A_fDH([]A\A]A^A_H{PHHHH56UIL=15Y1^SLAH{gPL=;IH56151fAWAAVIAUATIUSLHdH%(H$1HI9HI9tVL=11H56(5H$dH3%(HHĘ[]A\A]A^A_@L$wHIH1H6L; MD$P1LHH6HHMt?ID$PH5WH8IHjHE1SDLeZYtvH!fLI5HHIt$H>fDL1NL<IH5413f.M1L<H543@Ly 1ɺ1H5v413`M 1L<H5@4Y3,*ff.@AWAVIAUIATAUHSH(LD$D $ȶHDH4@IEPHHx=g HD$H'1LL 1ɺ4IHHCT$H@IUPH:UH53HUHDLT 1ɺ=HH$NH8NAKL1+NH4$HtH H4$H$Hl$1EfDMtDHT$A1LIHH@LL.IH5*%1A$H\$8dH3%(7HH[]A\A]A^A_@L 1ɺH5$11#IOAWLHL$AHAu9v)AG8LT$D$ AOLT$D$$[IGH@IFPH5FL$H8L$HIGAG8LL$HD$(誀L$Ht$(1A~`EjAȉWLt$AT/H uNL=L-9IH5#1"H $T$ LHt$ÅSL+D$$L3ÅH $T$ LHt$tÅLÅNInX=DH|$0@Mt1H|$0AEIFPLAG(AGHɥHLIą#H1HxHtsfHH1H9t1uAt$(P P$p(HH9ug=A;l$LI$H@HHxHuLO 1ɺCiL;L+IH5*"1A!@H|$0LÅL 1ɺ]1H5! fDL 1ɺNH5! qfLy 1ɺ(D1L>ÅDT$_H|$0Ht$hDT$c;DT$>LL$pH5 ZLH5iLUH5$YL7H5 L 1D$L:#H5xD$H\$Dl$(fDH|$00AH5H JHNPL1ɿR1E H5 *_AXH<$~ A9MIcH4@HD$0HH@PHx8J HD$HHHD$0H5D~H@PH8HD$(HwKLl EHD$pD$HD$8HD$hHD$@SfD3Ht$(H;pDHJ| Ht$(H;p$@EKL1HAO$vMIJ| 9sH4$HL$8HT$@DHAaDD$EHC@H{T/1L]IH51KLȅth1Hl$XE1Dl$\H݉DL,@N4J28 HB4AA9rĉډHDl$\l$X)ЉCL@HcD$HL$HAHT$hH|$IH@HAH4LdHVHD$pID$赌 H|$ LD|$裌 ~fDL4$H,L LHHE E SH5gL P1vYE1^H\$xdH3%(D HĈ[]A\A]A^A_Hx-IHJ|0-SL1AWIH51EA)HH}H5JL0HL$`XZDhHL$PHAHHHH}DH5TJL0HL$P2HL$PHAHH HK H4BoJD2HD2HBo  JL0HL0MLfDH<$׋ uHt$0HvPHt$PHH9$8HJ| ,HD$PHJ| m,H1ɿHT$XI1LH5R A\XE1LH5`yL H5>1UE1DHH4$J| C%fDL 1ɺ1H5DL 1ɺ 1H5D$D$L 1ɺ 1H5D$D$0Ld$hDuLDT$LDDT$H9EAFLIT1f1ɀ?AHH9uEE1H\$EL4$LDl$(IDT$80HD$h<AQACA9GLEHqH [ILL,J|(uILJ|(ɞuAE0LR #H|$0$ *LHKvIHx)HLUI H514AZA[D$L 1ɺ H5E1D$ LH51D$DT$8 LD$뷹LH5[yL~H54RL 1ɺ H5.E1HL4$HxLDT$u HLHxDT$vD$ L)$HJ| H(H|$0H;(HL+SI H5h1 XLOZ H5B1Y D$H|$0'HuADAVIAUIATIUSH*H9u'fHuI}3vÅHmI9t@H}ÅuL1?H5  []A\A]A^fI,$I9u#fH}wuÅHmI9ttHuI}gvÅu1L8 1ɺIH57 P []A\A]A^D1L 1ɺDH5  []A\A]A^@I}Åt=[]A\A]A^Ð1L 1ɺKH5  []A\A]A^I.L HQLUA1H5t  XZfDAUAATIUHSHH?Mt L tH[]A\A]f.HLHÅL̃ Et HHH}^ÅuHL) HLAUc0fDHL HLUAO1H5R k XZH[]A\A]@L! 1ɺW1H5 7 fL 1ɺ]1H5 1 AUIATAUHHSHHfLCXMt9ILCXH1HD Ņt(H[]A\A]fDIH$LO fIH5J 1a H[]A\A]@AWAAVAUIATIULS1HH$HL$ӌIfD@tpLHIutIFHpuID$PH8HtHH<$HEHHD$Ѕu$L 11TH5 D$ AHD[]A\A]A^A_AWAVE1AUL-`ATUSHH8dH%(HD$(1D$L|$HD$ HD$HhL`LHD$ H$fH$MLLH L1LHsIHuˋD$L-H LFHD$H{PHp8H|$IKHH$/"HL4AUI1AWHT$H5RRjH Ll$ 'E1H NLLHL1LHIHu1H\$(dH3%(H8[]A\A]A^A_L 1ɺH5HX!H|$H[HLSI1H5vXZhLI 1ɺH5Ca<ATUHSHH9hEt|$ L%tLe(H賐HH ATL UI1H5XHZTt[1]A\fL 1ɺH5[1]A\f.H(HH HLUIUnff.@E1E111HD$ D$D$@H'ATUSHs H-tH)H諈H蓏HIxUATI1L'H5XHZ4t[1]A\fLi 1ɺH5c[1]A\f.HN(HVt$;ff. t 1 tf u 1 uT@t u?t @u*HHH1H8{HfDATIUHSqH8u5I$L9t@HsHHI9u[]A\LH5Hn8ÅuHL(IH5"19[]A\fUHAWAVAUIATSHHHHdH%(HE1衆HHË@L%HHHH)HH9tHH$H9u%DHELyHDHHCL`A HHH { H HHz H0HHz AE[tIEPH@LH7LAƅ Aƅ}HLHHT)HL%HH= AAEEKHa:H1IEPHLH5LAuH1*XL2Z1H5IEPHL-LAuH1H5Y1^L;H5LP1H5jvLxwBHBHLHI݊HLMATIH51^_E1HudH34%(DHe[A\A]A^A_]fDkLIH51fH)HLfLi 1ɺW1H5fDCLERH8HD:EE1LE1DEHxHtGHGXu<u5HBHt,H@Xu!uHfDAEt2A%HJD HHXHJD HHXKLAA9DL$@HILDEtHLDE2L[H5'1E1;+fDDsLEHtHw AƅNLAHc1IٺL^H5@H1Ƀ1AXAY@HHxP81ɺALJ H5Pn^fLLIH511!@LfELED9pHCPD9sD@  E1LE1EDL4@賋nAFAKLA A9D1LHL$RIJ| Au_AuHLJ| AuHE1JD @ZuHJD @ZwbHHJ| 3DLL$AƅLLL;u)YDI|$^d3M$$M95IEPIt$H8Heu1ɺAL H52"HLJ| )vHJD @Z`I}PD膈DAzHLDE1DAHfLE1DLHHD6DAE[fDۃZEiL}IAE[@L1LA;\$LL,@I$IJ|(G[tHtI$J|(Hǰ$t vI$JD(HI$JD(E1@[tDHHLI9t-@H:uHRHRtDh$HL9uLLHEL P 1H5 MA_XM9LM׉LfDIutH@L`A$uaA$A+$D9H*LIH L AVI$H5F1bAZA[M?I9rL(L 1ɺ-1H5L 1ɺ41H5E1H$1AASLw H5IEPAH@XZL9HL IH5a1xY^fL: 1ɺ1H57P,1E1LL> H5 LLLLHHH~H LSI 1H5[LA\L]DIEPAH@L HLPL 7L# 1ɺ1H5 9)SLt[BLHH@H4 I HaXH HHaXH9uߋE1L@L:AƅAL\yH!LHHH@HINHH1R IEPLHxJ, HFHHxLHAHINH1 @IEPLHx, H^HSLHAHAD9HDH HtA4H4HtHH@HLtHHDHHHIvHAFZtLE1!HI&HLATLMH5>PHC@P1LH 81ɺAL H5!L 1ɺ1H5LA{LIH51HEFIEPHHsLL1LHD)M}Aƅ5LLL;ufDM$$M9IEPIt$H8b\u1ɺ^AL H5 LH1 H5LAc L<IH51Lp 1ɺ91H5mbSLE1MLIL!IDKDAD9EIB"KvD EuIDEuHk HHYk HDH5胭LHKDIR1DLLLBXL~IzNHnk HIj HDH53 IDHIV1DLLBXJI~9NAWLLL]HLHDžh&H11LdP L 1ɺH5L 1ɺ1H5~L[ 1ɺH5Z1qSLlHDj D}L L~TIH51Lϐ 1ɿH5SLL 1ɺML 1ɺH5Lq 1ɿH5pSLLMAL IH L{RIS1ɺE1L H5 *LMAL IH LvWIS`1ɺqE1L H5@HN(HVt$ff.AUIATAUHSHH(dH%(HD$1Ht$ Ht$LoLl$Ljf.tƒA|AuEuD9d$ t HL$dH3 %(u~H([]A\A]L gH51L} 1ɺH5|1뗐LlH5PnHH5`HtHfDL 1ɺH51DAWAVAUATUSHL>I/L9twIIL1f.HEHDII9tNH&f Iw1LDcÅuLu 1ɺx1H5rfH[]A\A]A^A_f.AWAVAUATIH4@UHHSH(D$HH $H@DD$H@PHx] L 1ɺHT$IŋD$Ll$MHD@MtLH HHD$fDHI9eHI9tfL o&L1H5b{LD 1ɺ1H5AZ1H([]A\A]A^A_fLH+D$HHXH@HuHIH1ɺAUI1LH5HD$H!CX^_HoGHHTH5(HHHCHHL$I_H<$LIKc M9D$;ELH([]A\A]A^A_ÐLH+D$HHXH@ f.L 1ɺH5@HPYL 1ɺH5I@L 1ɺH5!@HI9tHDžHDž @AWAVAUATUHSH8dH%(HD$(1lIH@H@@<I$SLl$La ID$HM$HD$~ LwIH51AT$LE1LHLJÅID$IDŽ$@tHEPH8舦ID$HHEÅH}PLt$M9uM6M9HEPIvH8DQÅuL׈ 1ɺ1H5LI$ui ubHt L 1ɺo1H51HL$(dH3 %(H8[]A\A]A^A_f.HRDH L\IH511Lt$M9ufM6M9HEPIvH8PÅuLLJ 1ɺ1H59L 1ɺ1H5 f.Li 1ɺy1H5ff.L 1H53LLÅHD$M$H1IID$ LIH51Hl$L9ufHmDL9H}DsBHUM1LÅuLc 1ɺ1H5`y@L9 1ɺ1H56Of.fDL1H5 hBfAWAVAAUATAUHSHH(hIH@H@@tEuNE@DAH߉D$衼ADžvEeIEH L5HIH@HMELE -AWI1LAVH52H{PY^qADžHH5Wl-HADžADžwL׵ADžlrEEImHDDd$EAADžk1DEH1躢HADž@ADžbA6@HE1LAIH5'1>H(D[]A\A]A^A_@LsPHLHL}(HD$IuLHD$wLHD$mLL$HL$MHT$HH=.1'-@LA 1ɺ:1H5>WfL 1ɺ11H5/f.HL<IH51@sLHxlHLSI41H5XZgD+LH0lHLxISKDL9 1ɺ>1H56O f.L 1ɺF1H5L 1ɺO1H5@AUATAUHSHHDl$@dHDHDH[]A\A]@AWAVE1AUATUHSHhHT$@HL$HLD$PLL$XdH%(HD$(1D$ {D$ IH$HD$HD$0L`HD$ LhMt5Lp H@(D$0Ht H$HЉÅ'H_=ÅH}P1LgÅHe LoIH51Ht$ HAÅMtLHAԉÅH LzIH591PH<Å'fDL 1ɺd1H5HL$(dH3 %(ZHh[]A\A]A^A_fHEPLH8JÅHOL=ZIH51fDD$ =JLA 1ɺ}1H5>WKfLi1OH5, L~ 1ɺ`1H5f.L~ 1ɺq1H5f.LX1uH5fHN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt${ff.HN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt${ff.HN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HAVAUATUS9v|9w9tXI,IID$PH8*IID$PH8AVb1AUI1L H57PXZ[]A\A]A^Ӊ[]A\A]A^AVAUATUSH]HŅHH*A9tmHCPH8IHCPH8lHIQH?AV1AUILz@H5t11ɃDXZ[]A\A]A^fHCPH8Nff.fAWAVAAUATAUSHH\EC\qHHeHpHF SD9H8H(DHTAŅDDHD9VEHHt 8H萰AŅ=HCPH8HIHIbAUL1ATIH515HsX H5P@AmDL9 H5XvAHDT$H1ɺ UILH514AXAYDT$fDH߉D$LP IH51DT$HMHH@@G~L1ɅtXLl$l$HDd$Af.DH@HL,LtHxHgAD;eLrH@ L}IH5 17E1L|$PHD$I9l$(LIDd$,$@HEHPHrHHUHHrHL9`LB H9uӋT$LeH5 H\ID$HHHmD$Lei 1ɺp fH0 LEIL 1 H54Ll$PL@ fDH\$PHl$H;\$uf.HH9H{0uLh 1ɺ H5WHLDl$HDd$Ll$oH)D$PHxH|$`o HzHxfoT$PHD$`HB9NLfDLQHHHLf UL$0IH51 AZA[Lg 1ɺk H5@H=VEu>HKHH`JHHQH HH=H1L 1SH5azAT$LLLHAADžIDŽ$H LCZIH51HBHLIƅ1bf.@mLq LIH51躾HI#GXH IGXA;nLxI1H5JH@HHLLx1IH4HoMOHLoH5 9L_ 1ɺ\H51E1$L^ 1ɺQ1H5־HL$(dH3 %(DH8[]A\A]A^A_fAL^ 11FH5蜽f.Al$LHHE1ADD$ []A\DAWAVAUIATIUSHHt$dH%(HD$x1=HMHPLALHHAŅHDžHCPH8wHEHD$AuCHL$xdH3 %(D&HĈ[]A\A]A^A_f.fLH|AŅu)L"Z 1ɺ1H58fDH{PL蟭AdHX1Z11LH{kE@t-ALt&1H,\H\ @ADHHm(dLHi'U7ISL fDAGL/H0mD$LM= 1ɺaH L4QIHH5#PHP11A[A_1HL$H9IHH@H@H舶 XH5ĜIL81ћHT$11H`D$L}< 1ɺZD$Le< 1ɺLfHCPH8YIHHHEHtXE;gLL< 1ɺ1H5 %11LHH$H@@*T$1LHܵ D$L; 1ɺDD$L}; 1ɺHm(H%HLIUL@; 1ɺkH5:XE1HL\$Ӵ LIH51AGLHL$(LHT$ pSWL\$HL\$H $HDh8HH$L$L$HPH$~AoL1HL\$L蒴HD$ HxHzHD$(HxHdHD$(Le(HHhX"HD$ HhX!AGLdzH5QI 1ATL AGL^_Ht$ LHt!AGLHt$(LHՎL9 1ɺ1H5謘D$Le9 1ɺLR9 1ɺSD$L;9 1ɺqD$L$9 1ɺZL9 1ɺD$L8 1ɺ0L8 1ɺH5lL8 1ɺ1H5ٗFD$L8 1ɺL8 1ɺH5螗 Ԏ@AWAVAUATAUHSHHDl$HDt$PL|$XEDHHLL|$HHADt$@H[]A\A]A^A_ff.f.wAWAVAUATAUHSHHDl$HDt$PL|$XEDHHLL|$HHADt$@H[]A\A]A^A_ADžL13 H5}}舗L̥B IH5}1|H|$(RLHGHL?IS jL!L], IH5S}1j|WLm.HLIH IH5}1.|I~PL訖L<O IH5|1{H|$ADžL 1ɺ` 1H5|{Lz 1ɺ& 1H5w|{}L-H|$HADžI~PHH(nADžI~PUI~PC0ALE1襕L5 IH5{1zLqL2h IH5{1zL 1ɺ^ 1H5}{zLZ 1ɺz 1H5W{E1mzZL1 1ɺw 1H5.{Gz4}qff.fAVAAUIATUHSIHEPLMt"H=pLÀۅH LÅID$@HQHAD$Lx/HL4@II$LJ|0kuwIuLԤ 11H5 z%y[]A\A]A^f.L1 H5yx[]A\A]A^ÐI$J|0nI$HJD0H`XÅWH/II$J|0H1Iٺ L?H5Ey@H11AURxI$Y^Jt0HEPH8gÅA|$LH詒HI$J|0蔒H1Iٺ LA@H11UH5xwXZEH?LIDLH=¡H1f.H訑L1ɺ IH5w1vAD$Lif.1L H5wv[]A\A]A^Ð;LW IH5mw1v[]A\A]A^fLY1 H53wLv[L  1ɺ 1H5wv.f.H蘐L1ɺ IH5v1uff.@AWAVAUATUHSHH_XLoPHwHI}芬 IHfH5\xHiHLLHIH HpI}1HK+AąMvLPL\HE1HTRH @HH9tH9luHL|HH9uMI}LAąI}HHAąIFXL%H EXH"HEXAąLHIH`1"IمLH5#u@H11ATA*tXZ5fD諎 LʟIH5t1E1sHD[]A\A]A^A_H` LIf.L8L$IH5jt1sLA 1ɺ 1H5>tWsafH؍ L_I(L 1ɺ 1H5ssf苍LwIH5s1rLE1MHHBHH5sSIL 1rY^LA 1ɺ1H5>sWrafAWAVEAUATIUHSHH$T$L$8DD$HD$0dH%(H$1LHË@L$D$ 赧HCHt$HP 6 DAͅ)Eu C8$HU<$@$D$u#D$uID$PH8hHUD$HsL{H~@IGPHHD$(H(HM(l7HU(LHT$@衋H1ɿHT$HI1L5H5qRpLSAYA[IB HHEHE1{LHHFH|$(.IH H9tvHD$@HP(HHCHT$(HxPWHT$(LM(1LH5qRP1.pLM(Y^L1ɿH5p1pLT$@EHCLD+xE1HsLH{HY@HDxAv&Au HtHHSDkLf.Et A $t9$t A LCL}(HULMHIp(LD$@LLL$(j ELL$(LD$@CLAPAm9eXA]D,$A]CL$<$@WA@1E1LӛH5onL~ 11H5{onKL@u9)AEf{LHHAw?IOPH HL$(fDLm(HHLYeHLm(H{HyAULUI1H5nmXZL5eAD)D9t-H{(L1ɺIH5]n1tmHCLHAu3Et.H{L1ɺIH5n11mD\$E2Hu(H=LsHULI~Iv(hI93A>LDHCH@PLHHx IHH9kHLpLLDL q1LH *HVs VHM(H{HL$(HIHL$(LLH1蜶IHfLT$XAf7ALEAADHiHHHEAFLUAu9)ЉD9m fLD$hHXH$H{tu t@  HUHL$PHs(`"H$DpLECDÃA9G@S$T$LHt$P8~Lv<H$It$XG5fL 1ɺ1H5cbL 1ɺ1H5cbftA8Hu(H=i HI{Lk AAvEzEH{LT$(|HHAWH5bUIL֏,1aY^LT$(fLL ODI HHcхbƍHHtQ@LǍHHI HHcхuA{L@H{A{HHHLĎUI1H5aaHk_AXHD$ A;D$A;AFLUAu9v)D96MFMH2HHLEAHH5Hu[HHLHtHHbH4H3HE1IHDy@1ɺE1L H5`_#L 1ɺ1H5`_f.Ly 1ɺH5s`_$MfH$H@HHD$ H$HxyL IH5_1 _FfDL 1ɺ H5_^L 1ɺ 1H5_^ELec1D H5p_^ĀE6{LqH{xHHLiqARIUH5_1 ^_AXILb1&H5^]2H{vxHH{HLKIU덩 Hu(H=tHE E1LxLt IH59^1P]1A@L:H5^!]L 11 H5]];L 1ɺ 1H5]\L]wLsIH5]1\.AHCH@A ^H#E1HHEH $|$ ; |$9A9I89$LHt$h4=LvHIL, H5\11[|$hG1111L {+AAu A  CLA EzD)A9 EH{uHHD$@AWHT$HIH5\1RLF$[XZL 1ɺ#1H5[Z5HE1M$t$L}AAF89$D$A;sL+u H5i[API1SL_sZAYAZf.D$d9t5LA)tH$DL$dLŋHSD+JAV_ PMH$H89$ID$P$H8vLHD$P~tH<$HD$HHD$@H$p8ID$PH8gvHD$ 轿1H5Z@H1HL$XQHT$X1RLD$Xk APLL$@LzYH LA9WfDŽ$HHD$ H@)$)$HPt AHD$ HT$xLH8L$@HL$|]j4  HD$ H9ht)۾LH5Y11XID$PHL$(E11ALH8lu11g.HL$pDL0+HD$ P(HpՋFHFu9)F)l$pA$HFu A9D)Љ|$p)1HHL$HHHHʼnHD$(ID$PHH8vtHL$HHD$PID$PH8HUtLHD$H8r$H5pL RHT$XLDLqH5WXRHL$XQ1P1_WH 11LH5X:W|$n *LL$(LH5W11WL%H5W11VL`qE1ɺWL.H5WP1VAXAY|$8 |$u6LqH|$ HDHH=)H1ƠHkIl$XAXAY1LDE'LE#uKLIk qH5QIL1PHL$01L*ALj wH5:QIL~1GPHL$011L*E;uL$AE8Il$XH[fATUSHu [1]A\DHHHtHL!HPTHCPH8[]I9A\ff.fATUSH:CYuFHtFHHHtN@[uHHuHAątAD[]A\@LcX[]IADA\@1Lw 1ɺH5y=D[]A\HWHO0HGHHNXBuH`XÐHwhHD@AUEATIUHSHHOTHwXHWpHI$H߃uHKXHEHHXEuHHuxH[]A\A]镵 DHH5SHHHxhtHx1HH@hH`0HǃHcX[DAWAAVEAUIHATIUSHHM9MEPH޹@H=x藒HHDH@PH5H8HHE1E1j1HHjjjjQjjjz9HPIHHHV E1DLLL2H[]A\A]A^A_ÐML$HLx11H5w5;Lx1H5vw ;f.L 1ɺ1H5Iw:hf.LxH5w:Lw 1ɺ#1H5v:Lx1H5v\:f.AUATIUSHL:HHoAŅcC[*I$HxxY C[t&HtHLHH9FI$Hx蕢Ņ;IDŽ$L7H{PE8HHCPHH8ŅH{P^nID$PLH8fŅHCPHH8-Ņ=LKH}1L;H5Uu8lfHCPH8T&ŅHCPHH8諢ŅqE1fLg 1ɺ0H5t1}8H[]A\A]ùSI$LvH5tH@LHH1<8H[]A\A]L 1ɺe1H5qt18H[]A\A]tH{PH[]A\A]@O,L?R Lsv`IH5s17HML$HL;z1xH5sG7fLKH?1LuH5s7HQL,u:IH5Ms16_@L 1ɺoDLKHj1LuH5s6H{P_ f.SHHCX@L r t21L\vH5r.61[f.HHCXtHL &uuHHt H0 HHt H$HHuaHHt H H [DL q"@L m@L q@H1L !rLt1ɺ1H5q5Lt11H5fq41Lt1ɺH5Eq4[@L |qr@L qb@H訫L q BL |q6SH#HtHPBtH[H@LKH1LytH5?(41[@USHHuDHHHt"HH,ŅCYuSH[]DH1MNL1tbIH513H[]DHNL1t1ɺpIH5u1\3HcXtL 1ɺj1H5>'3LfUSHHHt<Ht8HH},ŅtWHHǃH[]1Ls1H52H[]ÐLY 1ɺ1H5o2ff.fH1Ht HP0HHf.HHG@t^LHuHI9u4@u9PtHL9tHwH9puHfD1HÐHGLLrIH5~111HfL( Hff.AWAVAUATUSHHHG@MIAALEŅtaH{MKL1HKHH5}SIL_r410Y^H[]A\A]A^A_HC H@PHxd HHAADxH@E_HHD$ Ht$EHH AAL bH LELA} 1XH5}/#H1uJLq-IH5|1/fEI1L H5|/@L`HDhEH0 L /@IH71PE1LpH54|/XZBfDHا L a@Lp1<H5{.HHD$r Ht$M[L d@UHSH8dH%(HD$(1G\ HPCH/d¸HHH9u |HH9tqHCHxctHCHxHLNpIH5{1-'@HEPE1E1HHH8BuO1Ht$(dH34%(uIH8[]fD+HLoIH5z1t-1볋$1$ff.@ATUSHG\ toIċϝ=t1ۅÉ[]A\D;t/ID$Ht%H@ H@XHtHKPH=1H9ЉÅtHz=[G1۹L-oI1H5y,[]A\L0L$IH5y1i,@@HH H @x}=@x}NиH)AWAVAUATUSHH8dH%(HD$(1HGH@PL HD$ H{ALHVH{HT$ !ZYHT$ HBp8D@0 ȉ ȃD Ai@BO9jBD99HBHH90HH¤ uHT$ HBHHH;tqHH-C薤 H{LHZxHDHD$ E1H@L JEHK1UILnAUH5w1AT*HT$@H H:] H\$(dH3%(D>H8[]A\A]A^A_fDH0CELtwLDH w@HDHw@HDL=}wLD$LD@H{HL$L5twHT$LDyDHLD$ IH5v1APHL$ LYlQHT$ 1RAWAVE1)HT$PH0HB@8*LE1DLIHD$ pDH{HCAU1ɺ?UILl1H5Lv5)HT$0XYfDLDLIHD$ prDH{ICAV61AUIH5u1LkE1(HT$0^_B@LDLIHD$ p DH{ICAWLFk1AVI*H5{u1E1d(HT$0AXAY fDAL 11H5Cu,(bfAWAVAUATUHSH8HGPHWXHH$HL$@H%HD$1HD$ LHAdE1D$,I9I ILgXuH|$HID$VH|$HDL$IWE9ELA9DOH;T$t=HHHD$,HL$ H9tfHpHHvHH9uHEPM?HI9JH;\$ HL= kx;H9HH-EtHD$,H L%z?H|$HHT$CUL k1AWHT$ IH5ks1RATJ&H AcEH8[]A\A]A^A_H|$HD$1HHL$ HHHH9tf.HPHHRHH9uH9\$ sHEPf[HHD$HuHD$ HEP1聋1LhjH5wr@11Z%Ac~5O1LjH5Er@11(%E1LjH5r@11$H}P9H9sWHu,L==H-dr#H|$L%=G?H$L=iHkH|$H1AHAc EGHD$ L=U=fAVAUATUSHoTH9r%1HHuA[]DA\A]A^fHHI@AąuIEPHH8@IIIEPH8@H{Hd>LHY>HLjAVI1UH5pS#H D[]A\A]A^f.UHSHHHt&H莐HHtNHXHH[]H=LpIH5*p1#L 1ɺ1H5o"DSHWHGBHHH91HJH9BH9uXw.A1 L_pH5~og"[11L pH5Qo:"[fDH1&1ɺIH5^\1EHD$@D}$L 1ɺ:;f.H+HL+PHD$H>LH(@%jLYH5[E1[fD$Lf 1ɺDHH 1H@AWAVIAUATI1USHHdH%(H$x1H|$PH|$HHCPH8HHD$PHCPHHx֥HD$HI $H#HD$AL$HD$(AF4HCPH H8҃)/*H1ɺUIL1\1H51bf LD$1YHAb^龀MLLD$ LD$AoIcHcLDPAF IIOL==v =ɃKL1LD$ HaLL$ LL$LD$ EA~7LLPAot@OHa1Lo LX 1ɺ-/HcLlPAoHCP1ҾH8HH@ Hu2HP:t HcHTPH@H8tL:[<H5`1E1 H$xdH3%(D HĈ[]A\A]A^A_fDL$H龀1IHn`Hp LY 1ɺx4Hl$XAHD$HD$(@L! 1ɺH5`1E14 EH̄ AŅaHD$HcHt$1L=ZHDPHD$@H$pHHD$HCPH8LIHLt$8%f HHt$pLLHHI<$u1LLHuHD$8H4HCPI4$H8&HW1PLL$H1L!ZH5^ XZIf LϾLD$ H^1LL$ LL$LD$  L 1ɺ"lfDH8$L YFIH5N^1 @H|$QAŅ-I $HNH|$(AZLCPH1AHHH9:I8H%LY1ɺrIH5]1HE1u#LIWIH5]1fn1I_LI H5R]@11@LA 1ɺ&DL9WE15H5];LLL$PL\]1dH5\ L)XiLL$PLW1MH5\ff.@UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$x/HHcH9s$H)HMHHt$dH34%(uH[]ø@AVAUATUSHH $HPIIIdH%(H$H1H\$@PQ MAHH[1HA 91H1MŅII?LqA$HL11A<$IEAH$HdH3 %(DHP[]A\A]A^{P MMHH [1Hl <1H1xIą+8E1LI1PHGL PH5Y1/_AXELtZ1ɺH5Y1E1A<$I1PHJPLU PH5Y1XZA<$I1ɺPHW> L PH5GY1E1wY^[I1ɺPHYL PLY1ɺ#pSHt0HYt$ALT11#H5XH[ff.HZHcH>HlHH$IOHQLp$H$Hp Hx IwAG HI+ HAG$WHSP\HIGH< AG(@AWAVMAUIATIH5\CUSHH8L$ dH%(HD$(1HGPHHD$ HHD$DHAuIHHƃDHt$ Lj |$ ;cNLP1ɺ1H5hSHCPHH8~hHL$ K6H)HHL$ H91H|$H `THH1AEHHHAo$LxAoL$,AoT$ <IT$0HLAT$8DXTAU\HKX@HmX?HL$(dH3 %(HH8[]A\A]A^A_DHC6HHt$ HH5BR1LcSI1dAuHHD$ H)H1HHCPAuHH8HD$c1LL$H5QLN@11AuAMHCPHH8]Ht$ HHCPH8IHLOUI1H5HQ1{XZ@HT$ LHHLNILN1H5P ;Lɜ 1ɺ1H5Pf.HXLGNIH5nP11f.LY 1ɺ1H5:Pof.L) 1ɺ1H5 P1=esUHSHH5HHuEH[]f.H5PHuEH[]f.H5{PHt%H5 H~u*E@EH[]D1IٹLfPH5OI1AfAUIHATIUHSHMH詹LNHC4蓹LOHC5}LPHC6gLQH ҺLRHC?LTHC,LUHC7薺LVHC LWHCLXHCݸLYHCʸLZHC 跸L[HC$褸L\HC(葸L]HC,~L_HC0k^HLC訲H{8H,LH`诹HIEH[]A\A]LO 11ɺH50MeH[]A\A]AWAVIAUATUSHH8Hi6 dH%(H$(1HCH$ HD$hHL$XHHL$pHHt$HHHifHH Ht$sHHiHHH H|$HwHDHD$CH5;H=ML$&HD$HD$HD$HD$(HMH$HD$xH$HqMH$H$H$H_MH$H$H$HHMH$H$H$H2MH$H$H$HMH$H$H$uHH$HD$ H$H$HD$0H꾀LH:L)HLhLL)H wH|$ L LA1ILfN< H|$0HT$HIHL$8LLL$@HL,H|$ IEHHD$P4HL$8HT$Hx&LL$@IOL9rLI8I9vMfDHH$Hl$xHHHHH$HHHHHHH9HFH$H II HL$E1{DCHA1H|$A1A1EAEH.H|$sOsHD$(LLHH H9q\HLHNH1UIL(I1H5PIXZEAH$(dH3%(DH8[]A\A]A^A_MILIM LH$HD$0L;$HL$0ItDEtiMLG11bH5H<LL$XLPJ11H5eHAH1ɺdPLL$`LI1H5#H]AYAZ@HLHHH5GUILRG1Y^EY1LL$XLIH5G@11E1YDH L\Ht$hH|$pHH+I1@EWH LMcHӪ7N<Ht$LHD$H LD$Ht$hMHH|$pHPF1U@AH}7HsLIcL LL$ Ht$LHD$H LL$ LD$Ht$hHH|$pHE1*DE|$H7H3LIcL LL$0MHt$LHD$ H 7LL$0LD$ Ht$hHH|$pH1E1oDHH$IHH$H$xLtD1ɺ*H5EPH$xHPH$PHPH$`HPL$X1I$H$hH$XH HHII dfHDIE1LLIHu H9wFHf.ARWL%GV1H5/L9XZ1HARI_VL1GS1HEHLHt H@H9CtdMɺPHKLDH1SLKH5KH{8XZHt腍HPb H{[" LF1[LH5YKcAUI(ATIUSH! HxHH& HH]Mt,LH% &LKHHHL+HHkCPVa HPHHjg H^g HRg HFg H:g H.g H("g H8g Hh g ALH1JLeJMH5JLDH1S XZHH[]A\A]@LqE2H5I1H f.LiE1H5IH fL9E11ۺH5`Ij[DHt7SHH'zt[ÐH{@H{HH[Dff.@SHHwHHPmHt&HSPHHSf HkX6[fDL 1ɺH5H1[ff.fHGHtH@HtHp8H]# D1DHH<# ff.HHHHHD# ff.HHHHHD" ff.HHHHHD" ff.HwhHxff.@HHlff.G(HG`Hff.Hff.DDDDDDATLU1SHL9tH{HL9u[]A\fATLU1SHL9tH{HL9u[]A\fUSHu H1[]H9wH11DLkH5EXZH[]@UHSHH{u?H{9! HtTHhHHH]PMb HuX6H[]L1 1ɺs1H5=EGDL 1ɺvH5E!H1[]UHSHHGHx Vc H}H0Gc H[]ff.ATUSHGHX H H9t7I1fH訝HID$H H9u[]A\f.1[]A\LDHH fff.@ATIUHSHWHZ HB H9t=DHCH@`HtHIT$H9HGHHB H9uHtH[]A\1[H]A\fDHLA1 L?DH5CHff.HGXH5XHtHpHO ff.@UkLSHFH!GY u-uyF=H[]fDt@tHtsL>I1H5BH1[]@L>{1H5rB|H1[]HH{HHL>UI1H5B%X1Z@HL>I1AWAVAUATUHSH(Dm9yHEHxZ9H}HGH@H@PHt HЅ%HHADH:HHADHwAHHHL$HD$H9 HD$LhALlIADHH)LkIADH@HzMMM9u xM?M9tpI uLkIADH@HL`kIADH@HuD$L 1ɺ.@HD$HHD$H;D$HHHT$HD$H9HD$ADHL`It$HI$I$I$HD$H9(It$HH} ADH?$It$HH}$ADH?It$HH}PADH?It$HHADH?ZBIt$HH\ADH?4ELE1tZDHL<@ILu#It$HHzADHU?AD9mLwHmH;l$HD$HHD$H;D$rAH(D[]A\A]A^A_LL;1H5=E1붉D$L 1ɺH5=1DT$@Hh1HHL:1H5z=E1B@D$L= 1ɺ@D$L% 1ɺkD$L 1ɺTD$L 1ɺ=D$L 1ɺ&D$LɁ 1ɺE1L7|H5<E1HzIt$HADHc=HHIt$HADHF=J|8HD$L- 1ɺ sD$L 1ɺ\D$L 1ɺED$L 1ɺ.D$Lр 1ɺD$L 1ɺD$L 1ɺD$L 1ɺD$Lu 1ɺfUSHHHCH@@XtuH[]ÅH9sHHH4L8UA1H5:X1ZfDL1L+8$H5:H1[]@i1L;,H5~:1*USHH txHCH@@Xtu#H[]@DA9vHP1LJ8H59X1ZL1L7@H59H1[]@y1L7HH5~916t9wPt wPfH1[LH5&901HfHt>uHLJÐSHH HHHt[D1LR7pH581[UH00HSHHHHHDHv HHHt H[]1Iٹ}LR9H578A1ff.fUHSH HHHE`H%HwHHೃzCtHHൃxCzgགྷpC}PDHC9tCcHH[]fDH蘜຃sCHH[]L1H527H5{-1A\fDHEH@PH8LX.1ɺ6IH5?-1ATIUHSHHtaOLHH3Åt]HzLH[Åt[]A\f1Lz+H5,L[]A\D1Ll 1ɺH5,[]A\AVAUATUHSHHĀdH%(HD$x1t;=t7Htj;=HL$xdH3 %(H[]A\A]A^DLt$Ll$ HLd$MM!;=LH5Sz;=tLLH=7Ll|$aD$ t:=JHl$ PH01HL$HT$HLD$H5s1 |$|$|$tUHSH HHtHHH[]ÐL)1H5*\f.AWAVAUMATUHSHH(dH%(HD$1H?L|$`Lt$hHT$LH AątrHD$HPIHIHxH0MtAEP1HHA Ht$HAE HL$dH3 %(Du[H([]A\A]A^A_LQi 1ɺ1H5)gDIHHLL$LL$I$.zf.AWIAVIAUIATUSLH(AhLH1Ld$`LT$hHT$pHHC0% HLCKPIxP9DAK E_LT$Ht$0Ht$SPLH AIHCAH@PLT$AuALh 1ɺyH5(10E1RDELL =HH=L1H0;E1IHDT$',DT$C1 u,Z7=AtDT$ ,DT$wAEAL1DLR E1AdDL$L,g 1ɺbLCIxPHucE1AMHHLD\$LLQD\$H(ALHL[D]A\A]A^A_f1KP9AE1۽sHsHxLFY HEH9AIHHC$L#&LHHH5&1TE1@LLHL$HT$LT$~HL$HHH{LLT$HT$D$Le 1ɺiH5>&1DL$H(D[]A\A]A^A_@D$Le 1ɺ|@N5=C1 L$1oH5%dE1L!e 1ɺJDHL$LHHH{L$1ɺ1IHCH5J%H@PH1灁DŽHCH@PHDT$.fDUHH5B&HSH_f t H[]fHi L$EIH5$1OH[]fDUHHSH$HHtlHn8HHCHC HHC(HC0HtHKLK(L 11H5$HH[]ÐLyc 1ɺ 1H5#f.AAIL9sWHH %H3xDB3賲H-̜8IHL 4#PH PL 1H5"UٻH |$|uA<$諯HL "PHL PH5?"1U肻H *贲H=y"1aAHA1=1DAƃ$DH-ȩb|$跩;L AQL !PHMPHPH5x!1輺H ;8蚮ATDzPH L !PH9L PH5*!1nH L3[ 1ɺ1H5!I돿;L J!APL- PHPHP1;UH-PH[IPL U1H5w ¹H DfD;藭L L ARPH^ PU|$ B|$ I<$HL;,M $H HڙL: A9HDQPHPR4;H-IDASL PH PU;軬L Lѭ VPH!PHTP;臬L L WPHO PH Pf.SHHH?dH%(HD$1|u@{1Ht$ 9CT$1HL$dH3 %(H[胮8ܫHL PH L PHpH5iP1謷H k+8脫HL kPHL PH51AQZH 1:芮f.AWfAIAVI1AUATIUHSHHdH%(H$81f|$.LLl$0D$fDL$HD$"D$*R[L$۫Lyw?/kHHuCD$HD$HD$ 9\$HLHC1SDL$MLH/ ZYH10A$xHT$Ǿ1UEA<$贤t苬8}IH HHEHPH7LҪ PH5u1RG覵H 9\$%1H$8dH3 %(HH[]A\A]A^A_DL19H5 ?1ë8HL H5P+HL P1AQmeD$ZHnohostnaHD$Pft$XH 80fATIUSHHdH%(H$1SHH޿ŅH|$uAH1H$dH3 %(RHĠ[]A\Hg1IATLH5XZk18§IH5PLG{ ]1AT訳Y^]+8脧;IٿH iH+HDH1PHMLt PH51RbHH é8;IٿH HÓHDHL PHg H5P1RlH @HdH%(H$1?tHHH$dH3 %(uHĨ踩S1HdH%(H$1?u"H$dH3 %(u6HĠ[@HH蘪xʋD$1%=@:f.USH葨HHH]u[H؋H!ʁ t€DHHHD@HDH8/tH9rH91H1bŃG谤tק8uHH[]>fD裧8;H HHDHIٹPHXL PRH51°H HH[]Т蛤;IH HBHDHL PHx H51P1RaH "1fH1[L/H5]fD蛦8;H HHDHIىPHc L PR.HCKff.AV1fAUAATAUHSH0dH%(HD$(1D$HD$D$fL$f4$ HG/HHDHtH H߅!DfAAIH :H+RHEL*1ɺH5P1XBZH1͢Åx?H1HL$(dH3 %(H0[]A\A]A^8Eu; 2U}IH 9HHDHLN PH H5P1RH ^@#K脤L-L%8I̡}LIIEHLڢ PHH5qP1R蜭H <A>l}IMDHL{ PHH5P1ATAH LN 1ɺ1H5_L1H51f.U1ҹfSAH5uLH8dH%(HD$(1fT$f $1D$HD$D$h1H藡tzuHD$(dH3%(H8[]@賢8 HL PHyL PH51AQH @a8躟HPL HPL H5^1AQ蓫H 8ŢDSHS t78u41IٹLH5 =[fD;IٿH H‹HDHL PHVH5P1RH [fDoFhUIHL|SH5w/H8dH%(H$(1z>t:H$(dH3%(H8[]f.HH蠢uH$޿țuH$H9D$uH$H9$yH軚i^8距1I5PHv^ H5PL- 1蚩Y^)8t8I1PHL PH571WXZ苠ff.AWAVAUATL%=USHL5=IM9xAHL-yfMN1L1LTߨA~ 衜AvI~I~ӚL˚HHIL9HHtI~HϟuL! EjAFLLO%D$IFHD$I16|$ݖi谞8 (1LPH|L~ PLL$1XZ+k8ěMN1LPVHPL=~ 1誧Y^H1[]A\A]A^A_H[]A\A]A^A_@AWILxAVAUAATIUSHH5HHdH%(H$811҃" P1TRRr茝_AXIH$L|$HD$cfBL1̚Elj}A>… LLE;x$tA>X1MuPHH5#PL| 1;Y^T@{;A>D$<$<$T$WL1H5ۥ;脔11ɺLF H5襥1H$8dH3 %(xHH[]A\A]A^A_f.HT$3H$H9D$H$H9D$f.A>M1PH{L{ PH5 1XZ@A>ȘA<$MH HmHDHLř PH& H5s P1Rx茤H 1A>hA<$MH KH HDHLe PH8 H5 P1R,;H ђMOff.@UHAWAVAAUIATASHH(dH%(HE1EHHH@HH%H)HHH9tHH$H9uL|$HHHMILzHMHuLL:auxADt$At[uLpDLHH]dH3%(uTHe[A\A]A^A_]H)HLef.DLH]uLEED1cAWAAVAAUATUHSHA*AAt:1E1L H5& CHD[]A\A]A^A_ÐD$ RA L$ DH=L-=DEL9uHL9LsHLADžuރ|$ ML H5} 1Ƀ" PDl$1AU茡{DQZYWA)@H[]A\A]A^A_D$ WA L$  ɑLA 1ɺHHH跗IHCHDt$ CLY H5 A1Ƀ" RD$P1跠^_HDQ=HsEDDHA11EHH='=2 DHpLA 1ɺH5 1/E1論HIL H5P1AYAZ@L$ DHaAFfH{בHϑLx@ 11H5q莟FfSHH=1=, H1Ҿc[=D=K8D= =D =Suu  =[L1ɺG1H5 i =[=R =D=> =D=* =D= =D= =D==D==D==D=:=D&=u=J8ff.==D=vJ8D=u==ff.=BJ8DUfSH)=)=)=)=H=H='H J8H(AH=j=1S t]t)u%H(H5I8[H=}=]Ǭ u=D*=DG8D=Dz=DF8DR=DF8D==D==Dt 1==F8Df=Dz=D=D.F8DF8DF8Dv=DHe =@HE8@H F8@H=E8@E8D=E8DH H1HHHuff.@Ht'Ht"SHH1HH[H1f.V=ÐAW11AVAUATUSH8dH%(H$(1Ll$L諌L=,E8L$1E1LLD$ ;蚌H{H D8;LH$=$HHHPHH)HT LF3L-=IcԃHkzHcHTAHAtc;1LAW48荋L"n 1ɺ\PH;H5PLK1oAXAYfDL$ H$(dH3%(H8[]A\A]A^A_3LND$ A蛍8H51PHLsm cPLK1֖^_1Lي]<8蕊lL W1PH7Lm PH51tXZD8LL <1Ll PWHPH51+AZA[]ff.f=u =H12LH5pЕ^=HDF=ÐH$u)= =~ HfDHAWAVAUATUSHdH%(H$13$===H1L=A81HHc=ELEHcs=EEE1L-A8L%uH-Fk HIHc<=C<7HHP1It LшIIufH$dH3%(HĘ[]A\A]A^A_5@8HHc=Au_1H޿06蓊81H5L PHPL^j 1˓Y^@5RB8H蒊;8蔇OL5I1P1HAT胓XZ跊SHdH%(H$1<" =t$H$dH3%(HĐ[@HHŃu)H=H޿ui=Ds8̆HL PHLԇ PH`sPH5>1蜒H O8tHL MPHL| PHsP萉H3!u =uH1H5==u=Hf.苈8HL PHL PHxrH5WP1贑H vff.Smq [HUSH-.Ho˃HH H)!fHs+f.:H_t!HAu+4vϸH[]=H[]Df.Gt<.lb뵸뮸맸ff.H5iSHH H!%tDHJHDщ@HHH)H5 軀tgH5H H!%tDHJHDщ@HHH)H5f[HHEfH[ATUHSHLHH蝃Hu=H I9uH5HH考Hu(H5@HlHHH+HEH[]A\H f.UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$HD$ IH$D$0HD$/Hc1xH rH9wH9tH)HUH H|$dH3<%(u H[]xHtgU1SHtQHo蟀H%t@HfHBu!>wHrH1[]H]u̸H[]1ff.fH3HfDHATUHSHIHH]HՄtdHUYtI 1$@Is9fI|$A $2IHJt LHAxuҍy@4vL@L[]A\Dff.@SHCHuNHIMu [L1H5h|1[ILdf.SHHt [DHh1[H‰ff.ATUHSHLHHHuH L9u[]A\f[]A\fDUHSHHHt+HHH5Nb Hf HHt.HH[]@HHT$蓵HT$tJHy, 붐HإLIH51!HH[]HHT$uHHEXHH!H9tH.H9H/HW'H4HvH%rCH&HH'HE@uHT$HHuHHHt f.USHHXHt$(HT$0HL$8LD$@LL$HdH%(HD$1HD$p$HD$HD$ HD$H-f.ƒH$HHt.HH}Hu$/vHT$HBHD$HHuHL$dH3 %(uHX[]ӀATIԺUHS tDH_g|HHt_MtHxL1蜀u E[]A\L11ɺ2H5 []A\fD1ۉ[]A\SH<=H;Htw~H[ff.USHH=H8Ht/rHHtzHxH߉hvH[]Ly1<H5T1L1KH5^.H[]DLS1AH5,f.USHH-7=H}tH[]f.H=O~ 1~HuyHEHtÅuH}+}HE뮐L"H5^ff.H=HÐWzAT1IH=UH1S{HLljkwH9u߻u[]A\c}8zHL .PHv L{ |PHPgH5P1茆H 1uÅt11L@' 1ɺ~H5X[]A\Ð|1ۋ82zHL PH L:{ wPHfH55P1H []A\1L& 1ɺH5υ[]A\ATIUS)@L |1҉)9w[]A\ff.f1fH= HƅH(\(HHcHEHHHHÐAUATUSHdH%(H$1HtW>/HIHH8IHt^1IH-HL诋 tbHL:}tMDH$dH3%(uEHĨ[]A\A]1Ҿ\>HI8HuDHHLړ {UHAWAVHAUATSHhL5=dH%(HE1EbzHL-=HHL9IIEHHH%H)HHH9tHH$H9ut H)HL_H\$HHJT+H9sf.HHH9wH1HxE)E) u EEKHx~L==DLsIHcLMu.Hx~D;}LItL=_=DKt=LHI9s@HHH9wL=*=H)=IELN11H5lsIH=Ht'I$xH@I$IL9wtE1LfK|I2tD9HEdH3%(uTHe[A\A]A^A_]~rIHT=Hx뙿_rIH5=HYxDAWAVAUATAUSHHD=dH%(HD$81EtKvHL$8dH3 %(sHH[]A\A]A^A_HHHE1H18L-H=S=HI9q=C=11yHHR18E1Hu#HH/18IL9vH5===L)LpHuH18L9pL-=1H߾CD5KE\$H uHD$HHDDd$HD$ LuIH`HL$0HT$(HLHD$,AH5yPHD$3PHD$:P1LL$ALD$@sH |$ rLcd$$H5MLsHyH5LsH<H5LsHRH|$HD$Lx Mt2fDA?uI_;tHLFsHMMuHT$0HD$(H5:LII)L}ATL$+QL$2QL$9QjrRLHPIHIº,H PLL$P1~H@L$LH|$(_s{MnWHH.8HxHH=hf{vt8'rHL PHL/s NPAQt8qL E=1LxT PhH51AU}AXAYIHt8q=<H HL^HDHDPHK L <PLr RmH511_}H s8:qHL !PH LBr IPAQM1LH5+|D$]HAULL$ LH51|^_'Dd$HL B \$LHEH5LEHu1n|XZL`1ۺbH5tC|Ivr8pA}H \HHEHMPHuL q PR5H5 1{H D$8H947L= H57H9|L;HLLoHtAULAWLL$ AULSLL$ {HAULPLL$ VH^HKq8nA}H [HݓHEHMPH{pLo PR0rfDSHǣKD  =P =LH5P =P =P1vz =H u = =t[D =1*nu1L1ɺH5Ezv =tB\ =1H'<HOuL 1ɺ%[H5y1ҾH= =u=<u'H@"HmH=<g 1H=<1om =ao8Em=<H .HYHDHL <PH PL.n H571RyH [L1[H5 xATUS6 =Mo11H{iÉ =tD% =D9R[]A\D}tllLO 1PHZL FPH5y1Kx_AX[]A\11Dku8HAٹATH5=LbxY^[]A\fD}kHE1P1LPH5wXZ[]A\Ë . =t =  =tS =11jtJn8nkHA1P1L.H5UwXZ =[AٹLH5Lw[ =ff.@SHHdH%(HD$1VD F =P3 =LH5P! =P" =P1vD =H Et= =t$HD$dH3%(H[f.1ɺ,H5y1LDH$7vHHt3D x=EtORH==&ht=sL 1ɺ/H5u==mdurH==gH$H9<H=zLL <H$HLH9suH1RH5L;NuY^0k8+iLK 1PHL n<4PH581 u_AXIH1RL?H5tXZ lff.fSIH=uH H= t@L1uH5lt=u=H[HLL$ALL$1L0r=H5<tHHfDf=SHt tEIٹ1LH5s$=~ =[fIٹLH5=qsff.@=D=D=SHDHD =AtQ1LH5.rH5c=t [f[ f.:=~L'1H5rD =ufDD =SHEtHt S<EN<H$dH3<%(WHĘ[]A\A]HL$LL$ LLD$H56<k|É<T$H\$L%nLkx9r6tdLK0M1H5!1HiT$L9t9sʋC H <L9ut1 r<H@C9D$wuC9D$ sfD$t uD$ uL ߤ 1ɺ=1LH5rhDL1 1ɺ)1H5[Gh}_ff.fAWI1L4AVAUATIԺUHSHH5H(dH%(HD$1gHT$LH# KHt$CL9F HHZ:E1DCLAD9HDE1E11H@Ll1IEPLH8{ADžuL݁LIH5<1&gHt$j1E1LbH5fHDKLHD$H5L@ P1fHt$ Y_H HL$dH3 %(D9H([]A\A]A^A_ALF 11H5p\ff.E1D$ /Ht$HF0B<(DuIL$XD$ AD9sL|HEE1E1KDm1H1L`ID$PLH8+zADžuL\L{IzHt$AUD$ AI|$P1RHt$A\HH5V2LYHHff.AWfAVAUATUSLHH$@H|$L|$pLHD$dH%(H$1)D$0)D$@)D$P)D$`HI@@@-{L@ HCHh eHHBdH E11E1E1E1AIIH\$=fAAE@@u\Lt LHI Ń9KHHH@Xt LHH LuHE@Hu=E!@tL11xH5c_DAAbI1HT$,Lt D$,H{}ML5IH5E11-cD$E11E1E1HHD$pHCPKLD$|)щL$xH@ uUHl$0foT$@foL$0D$$C@)$$CD)$$D$$C8H$HLL$H|$$j ŅDCLHT$1HH|$HH$dH3<%(qH[]A\A]A^A_HCTLLHHf.HP CLD$|D$x;@H\$E1CHD$AfA@11L^H5sda)L! 1ɺ1H5K7af t:CL$D$x9LHHeLfDSLTQ MLDHAW1H5]XZDH=A>AHCLDT$ HXH ILSPH5p1Z]Y^DT$ H$dH3%(DHĨ[]A\A]A^A_D$ HCLHXH, HL\IS널IL,1PH5\L1H5\E1JE1D9v)M{1LP H5n\룃H{v'AHG CP1sLCPSH{MV1LN H5\2Mh1LH5[LMoH<LO MLDHAWLj 1ɺsH5[LF 1ɺcH5m^[R@UHSHHHGWLH@ 1H5HHC@ tS8HC@t S< S@SDFSHt"H5HDuH'>@1H5H7S8u0HCH@H_'HDHHH[]u1D1H5HuL 1ɺH5 Y1H5fHOL 1ɺH5Y1H5ZHL` 1ɺH5xYefD1H51HL 1ɺH5G8Y%fDL 1ɺH5 YH1[]1H5H_L 1ɺH5XfD1H5YHLp 1ɺH5XrLI 1ɺH5paXK@1H5O HEL 1ɺH5/ X L 1ɺH5W@ATL%UHSwL1ۅAM1ɺ!H51WHH 9]LwHHtcMLt\1L%fHH@HDHt)HpH(1AM1ɿH5A2WXZ9]Lw[Lo]1ɺ*H51A\WSHH$)t [L1KH5V[ff.AWAVAUILATULSHHHdH%(HD$1HL|$PLt$Xp H$HPIHPIHpHxv> AEHt#Haw̫UPHHHHHH4$HAH HL$dH3 %(Du;H[]A\A]A^A_fDAL 11H5ULDAUIH5ATUHSHdH%(HD$1HT$$D$,HH5|HAA t@tupD$$AAEHL$dH3 %(DH[]A\A]DHL8IH51THE1L)>IH51TjKff.SH#Ht~LHIytn unD@L1EtAHA@1H @HBH H:uHRHRXHHH9uAuEAA9[f1[@HpLAEHE11E1҃tHD9th1AHRHNjAt׃uH@H@XutAtE빐H@AH@XuHIAfD[ÐAWL=#AVIAUL-8ATMUSH H1HHHD$OfDAG ML" 1ɺH5C1RHL說ÅIM9twHJHH|Lh Lx(IGHHHSH$ sHjHIHYH$H T$HC0HSCHCDH[]A\A]A^A_fM1LH5Q4@L 1ɺ1H5Qf.HH HFHFff.HFff.HH HFHH HFHGPHFff.HGXHFff.HcGtHFff.HcGxHFff.GpH HFff.HH HFH HFHFff.HFff.HFff.HFff.HFff.G(HFff.@HFff.G(HFff.@GHHFff.@GLHFff.@G8H HFff.H HF1HFfDHHFff.HFff.HHFff.G HFff.@G$HFff.@GHFff.@GH HFff.SHWHHHHRPHz1HC[fDSHWHHHHRPHzHC[fDSHWHHHHRPHzqHC[fDSHWHHHHRPHzAHC[fDSHWHHHHRPHzqHC[fDSHWHHHHRPHzHC[fDSH3HC[SHsH HC[@SH3H HC[@SHWHHHHRPHzaHC[fDSHWHHHHRPHzHC[fDSHHH HC[ff.SHǰH HC[ff.@SHH HC[@SHWHHHHRPHzHC[fDHHv?cHDSHbHC[fDSHsbH HC[@SHsbH HC[@SHaHC[fDSHcaHC[fDSHbHC[SH^HC[SHc_HC[fDSH_HC[fDSHHHC[fDSH]HC[SH]HC[SH3]HC[SH#^H HC[@SH]H HC[@SHHHHlHC[ff.SH\HC[SH]HC[SH\HC[SHCHC[fDSHHC[fDSHHC[SHHHHHzBHC[SHH HC[@SHH HC[@SHSH HC[@SHH HC[@SH#H HC[@SHHHHHzBHC[SHsH HC[@SHHHHHzRHC[SHHC[SHWPHHHHz5HC[f.SHWHHHHRPHzqHC[fDHH1E1dH%(HD$1HGPHL$H8gtT$H|$dH3<%(uHJ=f.SHHHC[fDUHSHHdH%(HD$1HGXH0ruH-r^H%1HHtH$XH8x HcHEHL$dH3 %(H[]H u@HHruL 1ɺH5EHfHCXIHh@L 1ɺH5DH9;SHHdH%(HD$1uHT$dH3%(u!H[@Ht$H#dtЋD$;@SHHHC[fDUHSHHdH%(HD$1{HCXH0rpH-H$H%1HH:rH$XH8v HcHEHL$dH3 %(H[]@HH]puLB 1ɺH5GZCH롐HH@H tHCX:1HHcrIL 1ɺH5BH0H$L 1ɺH5BH9@SH3H HC[fSHHHC[fDSHHHC[fDSHWPHHHHzUHC[f.SHWPHHHHzHC[f.SHWPHHHHz1HC[SHWPHHHHz1HC[SHWPHHHHzUHC[f.SHWPHHHHzHC[f.SHHC[SHWPHHHHzHC[f.SHWPHHHHzuHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzUHC[f.SHWPHHHHz5HC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHHHdH%(HD$1HGPHH8¶H$u1HSHL$dH3 %(uH[5@UHSHHdH%(HD$1H$3uOCZu)1HEHT$dH3%(u?H[]HHH$Ht@ @HHUH$ 5f.UHSHHdH%(HD$1H$蓴uoH$CZuUHHt"Hh HHHHHDHH$ Ht$dH34%(uH[]ff.UHSHHy`dH%(HD$1x>HaHHHHDHH$ Ht$dH34%(uH[]lff.UHSHHHdH%(HD$1踮HHT$H߉D$ Ht$dH34%(uH[]UHSHHHdH%(HD$1(HHT$H߉D$ Ht$dH34%(uH[]AUMATIUHSHHHdH%(HD$1LHMHHH$vHT$dH3%(u H[]A\A]6fDAVMAUIATIUHHSHHdH%(HD$1t HMuAHqH$LHMLHHT$dH3%(uH[]A\A]A^@H$fAUMATIUHSHHHdH%(HD$1辫LHMHHH$fHT$dH3%(u H[]A\A]&fDAUMATIUHSHHHy dH%(HD$1-LHMHHH$HT$dH3%(u H[]A\A]DAUMATIUHSHHHy dH%(HD$1}LHMHHH$HT$dH3%(u H[]A\A]EDHHdH%(HD$1HHP8HH % HT$D$ HL$dH3 %(uHDHHdH%(HD$1HHT$H@8H%D$G HL$dH3 %(uHff.fUHSHHH9dH%(HD$18HHHH$F Ht$dH34%(uH[]*f.UHSHH8H9dH%(HD$(1HL$ HtH8u,HD$ HHH\$(dH3%(u4H8[]ÐHLD$HT$HL$yHL$HT$LD$tff.@HAHH@X@u tyHt-HHHH593 HfHQt ATIUHSH HYdH%(HD$1HCXHHutH0QHUHAPH`cHT$HHT$L Ht$dH34%(|H []A\fD.HtH谿HtHCXH H)HgrH8t@Hmd@t;AHt҃HAPHH84fHp8H%sAHtuCHIPH_A8HA0Ha NfDH57H8HB Ha  @Ht$H[EH|$Hi`fDATUSHHdH%(HD$1A\tIHHLDu6HOH5O7H Ht$dH34%(uH[]A\fLHHR kff.AWAVAUATUSHH $IHHHD2HD$Pf.HI1LHA L$ H4$LL?ŅHH9\$tjL3HkLHILMlLQ IHuL1 1ɺH511EH[]A\A]A^A_@fL 1ɺLٽ 1ɺ1H5gff.fUHSHHdH%(HD$1AHt8t3D$HHT$H Ht$dH34%(uH[]@H裧D$U1HSHHHdH%(HD$1fHHT$H߉D$" Ht$dH34%(uH[]FfDf.AUIATIUSH(HYdH%(HD$1D$HCXuH0sFHHl$̦D$LHL Ht$dH34%(H([]A\A]H-t6Ht,H s,HH@H@ HCX DH ryH1Hl$qHCPE11HHH8;R|$GH'D$6fDHHL$g HL$HCXDHHL$CHL$H@H@ HCX'Hl$HH<fDH֋QtA yH(? HQ ff.@H֋QtAyH HQ ff.@HH HHdH%(HD$1HT$D$ HL$dH3 %(uHf.AUATIUHSHHdH%(HD$1HAXH$u~H r?HH52HI HL$dH3 %(unH[]A\A]fHtHCPIHLH8tLHL HAPIHLH8ӐuHCX`ATHIUHSHHdH%(HD$1H$[CZu=1H5+1Hl HL$dH3 %(H[]A\f.H踛HH$HttH1H fHH5H$H5C L H5v18f.USHH(dH%(HD$1A\tHHt$H>u11H50HH H\$dH3%(u'H([]@HD$HT$HHHD$ AVMAUIATIUHSHHdH%(HD$1HAXH0rnH%rH-s@HHMHLLH$HT$dH3%(uNH[]A\A]A^H!H5!/Hb HЙH@^uHCXtE DAWIHAVMAUATIUHSHHdH%(HD$1טHH@LhHLHHXH9M IHL m.H O1MHpHLH LHEL HHLLn HT$dH3%(H[]A\A]A^A_fDHLkHupAtfLHHXHL IHtgL .H .E@Ly1H51\DHLLL,$ @fLI DLʛH561j f.HH֋QLdH%(HD$1BLAO@OA8MXIMMCXu iAO@OA8uM@MPXt ЍPwHQ+BD$B t 1D$HT$t Ht$dH34%(uH ff.@AUIATIU(SHJ HHt,HCLkHvLc HHCHH[]A\A]ÐL)1H5Df.AWAVMAUALATI1UHSLHL@ƃMHtHJ31DHI4HHt,LL1 HL& H[]A\A]A^A_fH1[]A\A]A^A_ff.@AWIAVE1AUIATIUSHHHYILAƃILDI)HD$, t LT$1A::tIH[]A\A]A^A_IZHIDILLI)HD$+tLT$A::tIZ1uIZH1IغILLHI)`^H]Pf.LAHuL@SH 1HHY  I؅xL[L)1H5E1ff.@AWAVAUATIUSHH(H4$H5IdH%(H$1 HH H<$L$tD HH0HE1݈ H$IH$H$HD$E>EvIHPAfA9AWՃA:LfEgAL)H<$LHI>H>HH: H$LH$"IH$E>EOA L;L9dHl$L f. HmH9HEuHHL=17E1 Lu LmH5HD$HHE@HHt$Ht$I9tAt$HPI9uA|suHL/IIwAHuM1LPH57H<$H1yB H$dH3%(H H([]A\A]A^A_DHDHH HHP !t(#tuH gHHH HHH aHHLfE1ɀ8:fDHt$H<$H7L$JfMcH07KdHDHEP w/HL$Ht%HA8HH ^HHHE@L3Hl$I9AA-LD$-D$-?fDAt%I΃A9DBA9DGHmH9HM9uHH{ HHI荆 IHtHHz IN / (MtIE/ HHEHVfD;D$HmD$H9fDHHl$H9E1E1D\$=A9t E9E)E1 AHH9HPJAAut܃A9E#E1ɃAf.|$9FljD$DHM Ht Hp>ZHHQHEH%DD.DtLT$fET$VI1A-L$L H} LHHEHf.H<$A IHFHLH5H L@Lɛ11H5J H<$1> fD$-A-D$-f.Ht$0HCfoD$0foL$@foT$PHD$`L3)$)$)D$pH$HDŽ$DŽ$L9G1A1D|$]AD$ AD$HcL$HH)HH4H)H9HHOHiҀQHՐILH9IIFD AD$vAD$у w$f.+I~ 1IRAAAIIALEpAD$vFAA XA NH ׾JcH>DHQAHD$@HD$pAD$x-l$D$|D|$A)|A*gD$#-!H|$pH)|$#HD$ HD$(H$H|$ H$t Hl$ H|$(H$Hl$(Ld$ H<$HH$K; 1ILHЎ H vH<$H= HHLg1H5lDH9H wjH HMH HHHMLMLH5CfDDŽ$D$|H HMH HHHMDD$x H|$pD$pH)HD$ H;HD$(jD$D`ك-,AnH|$pH)|$!HD$ HD$(H=HD$ HHB8Dl$xuH*LIHLH?HH)Ћ$)H@H$H)Ƌ$HHcH9~  $)AH HBP @HIiŀ: HIiŀQHD)$LHL)HlDl$tLDl$pIiHLHL 1H58HD$(H LHL51H5hL91H5<HD$pH|$pH)HD$ H/fLHL1H5h,Lז1H51=LԔ H5Lף 1ɺ1H5eLi1H54f.LHL1H5LH|$pD$xHD$pH)HHD$ HD$(A)t{A-HQHL$(H|$pD$xHD$pLH)HD$ HD$(AHQHD$(1;|$#uH-HD$ y$$Lct;HBtHcHiQHDHD$(;AE D$xHcuHdHHHuHHHHtH<$H5 DUSH(dH%(HD$1IMHL˅t|t"Ht$dH34%(H([]1HL$HT$LH5uHH4 HtxHT$HHT$HPHLHy1L:6H5DH1DfD4L2;H5wH11Hu;HH HHEH HDH HHǹHHDH5HHD HHq`HLH]HH[ff.HHLHx7H,ff.HHLH7Hff.fHHLH7Hff.HqXHLH\HHff.HqXHLHYH*off.@HqXHH7LH?ff.@HqXHH7LHff.@HqXHLH/Hff.@HAXHH r1ĀtHHHH7Lf.UHLSHH(1HH߅Hg7@H[]XUHLSHHH1HH߅H7@H[]UHLSHHH7HHH H[]HƃfDUHLSHHHH7HHHH[]HƃUHLSHHH7HHHH[]HƃVfDULSHHHy@H7HHH[]ff.UHLSHH~HHHH1[]ff.ATHMUHSHu t9C[u1H7[LH]A\HuHȺuC\tHfH@ATMUHSHAXHH"r4u1H7[LH]A\DHؗ@H証uH蜘1@fHHH5 Hff.@SHHHAH@H)r5H*rHH[@SH7HLH[RfHLD$Hx}LD$HH@H@fSHHHAH@H)r5H*rHH[!RH7HLH[fHLD$Hx[}LD$HH@H@fSHHHAH@H)r5H*rHH[QHB7HLH[RfHLD$Hx|LD$HH@H@fSHHHAH@H)r5H*rHH[!PH7HLH[fHLD$Hx[|LD$HH@H@fHHeuH5u HfDH5I7 Hf.SHHHAH@u?uHHL[D1H7H@HL[@HLD${LD$HH@H@DUHLSHHHx$H7HHH[]f.HHH[]ff.@yHHt LHAPH7Lp@;ff.yHHt L{HAPH7Lp@f.HAHH@XH%syHtH0syHt7LHAPH 7Lp8@f.HAPH7L@off.@AHׅuLf.qHV7L.ff.AHׅuLjf.q,Hv7Lff.AHׅuL*f.q(H7Lff.AHׅuLf.qH7Lnff.HHAXHH%sJH3r#H57H#}P HfDH57Hh]- HH5)7H  HUHSHHdH%(HD$1HAH@H)raH*r:H537Hs H Ht$dH34%(uLH[]THHHH$ HHxwHH@H@^ff.UHSHHdH%(HD$1HAH@ t{HG^t&HPHt,HHHH$ 3fD@uVwHHuH57Hw H Ht$dH34%(uH[]@@tHPHuHH%H5% i Hff.@UHSHHHAH@H)r1H*sHHH[H0] fHH[]DHHxpvHH@H@UHSHHHAH@H)r1H*sHHH[HL]r fHH[]fHHxvHH@H@UHSHHHAH@H)r1H*sHHH[HH] fHH[]fHHxuHH@H@UHSHHHAH@H)r1H*sHHH[HD] fHH[]2fHHx uHH@H@UHSHHHAH@H)r1H*sHHH[H@]" fHH[]fHHxtHH@H@UHSHHHAH@H)r1H*sHHH[H<] fHH[]RfHHx@tHH@H@UHSHHHAH@H)r1H*sHHH[H8]B fHH[]fHHxsHH@H@UHSHHHAH@H)r1H*sHHH[H4] fHH[]rfHHx`sHH@H@UHSHHHAH@H)r1H*sHHH[H$]b fHH[]fHHxrHH@H@HAH@uHWH @HօuH'H @HATUHSHAXtIHHWr@Du HHvH5v []A\H(r[HL]HPDA\e DHATUHSHAXtIHHq@@u HHH5J []A\Hq[HL]HP@A\ DHATUHSHAXtIHHwq@1[f.UHHSHHdH%(HD$1D$t0HT$HH Ht$dH34%(u-H[]fH57HH ff.SHH HAH@H)r-H*rH H[H HHX[霮@HLD$HT$HxHt$_LD$HT$HH@Ht$H@ff.fSHH HAH@H)r-H*rH H[!H HH[ @HLD$HT$HxHt$Y_LD$HT$HH@Ht$H@ff.fAVMAUIHATIUHSHHdH%(HD$1HtHu?HH5LY HL$dH3 %(uFH[]A\A]A^HSC(HL$MCLHLHRPLD$ fyptHpDHH5M7HH辸 H@UHSHH(dH%(HD$1HAH@H)raH*s: HHL$HH HD$苭HT$dH3%(u]H([]@HH5H* HLD$H4$Hx]LD$H4$HH@H@mfHIdH%(HD$1HAH@X@u> u7HXH5XL虷 HT$dH3%(u/HyHuHAXLHH@HH$臬`SHHHHtHH1+ [@Ly 1ɺH5D`1[ff.fSHHHeHtHH1˶ [@LYy 1ɺH5_q1[ff.fH1H5:~ H@HIHtHgHff.SHyXHt)HH^Ht1HH1 [DH1H5 [ùL_ H5_1[f.SHyPHt)HH^Ht1HH1蔵 [DH1H53w [ùLZ_ H5^1[f.SHHH-aHtHH1 [@Lw 1ɺH54^1[ff.fUHSHHHy dH%(HD$1Ht7ҡHT$HHD$n Ht$dH34%(u+H[]H)H5)Hj nff.SHHH xHtHH1+ [@Lv 1ɺH5D]1[ff.fUHSHHdH%(HD$1HAH@X@uA u:HcH5cH褳 Ht$dH34%(u5H[]yHuHAXx^HHHH$l eDUHSHHdH%(HD$1HAH@X@uA u:HËH5H Ht$dH34%(u5H[]yHuHAXxnHHHH$̭ DUHSHHdH%(HD$1HAH@X@uA u:H#H5#Hd Ht$dH34%(u5H[]yHuHAXxHHHH$, %DSHHHYHt@8u#H5|7HHݱ [fDHH1ñ [@LQt 1ɺ H5Zi1[DULSHH tH7HH1H[]=DHHH[]AWAVMAUIATIUSH8dH%(HD$(1yHtOH\$HK HLLIG} Ht$(dH34%(uH8[]A\A]A^A_f.H= H HHHL{P褢HHIWxAwpHH%tQIAHHIGHLL˫ HD$  D$ 9fDLr 1ɺH5DY1Lr 1ɺH5(Y1@1Lor 1ɺH5X1LIr 1ɺ1H5X_DL!r 1ɺH5X9coff.@HЋQtH0HFfDHH UHSHHdH%(HD$1D$A[u2HHH Ht$dH34%(u8H[]fH8TpD$tHT$HHj ATHIUHSHWSt HHXHs H|]HtHL1J []A\Lp 1ɺ H5dW[1]A\f.SHHH~HtHH1 [@Lc H5W1[f.AUI1ATUHHSHHH~HtgHI HHtOHGR1҅u)HULHLO H[]A\A]HH@HP`1LRc H5DVH1[]A\A]ff.@AUI1ATUHHSHHH|HtoHI HHtWHwQu3HHEHLLz H[]A\A]f.HH@H@X1Lzbu H5lUH1[]A\A]ATIUHHSHHdH%(HD$1H$DugH$CZu-Ht@H LH艨 HL$dH3 %(uJH[]A\HQHH$HuHELHV @HHDH$jf.AUMATIUHHSHHdH%(HD$1cH$Hu=HH5H HT$dH3%(u(H[]A\A]HMHLHff.fATIULSH*t&L.H7HH߉[]A\VfDHH[]A\ATIULSHt&LHW7HH߉[]A\fDHH[]A\QSHHHM}HtHH1 [@L<`H5S1[f.AVMAUIATIHUHSHH dH%(HD$1HL$HT$_t;IGHT$LL Ht$dH34%(uLH []A\A]A^HEPHNL_LuH1H5;RXZff.@AVMAUIATIHUHSHH dH%(HD$1HL$HT$菥t;IGHT$LL Ht$dH34%(uLH []A\A]A^HEPH>L_LuH1H5kQXZ/ff.@AUMATIUHHSHH[Ht!HMHL[HH]A\A]雳HH[]A\A]&fDSHHHbHtHH1苧 [@Lj 1ɺH5P11[ff.fSHHH`HtHH1+ [@Li 1ɺH5DP1[ff.fSHHHMYHtHH1˦ [@LYi 1ɺH5Oq1[ff.fAWMAVIAUIHATIUHSHwHtrHLHH!t-IGHLLH[]A\A]A^A_隡 f.Lh 1ɺJH5DOH1[]A\A]A^A_L 1EH5Of.AUMATIUHHSHH]Ht)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHHYHt)HMHL[HHH ]A\A]f.HH[]A\A]^ff.AUMATIUHHSHH~ZHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHHZHt)HMHL[HHH ]A\A]:f.HH[]A\A]~ff.AUMATIUHHSHHXHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHHTHt!HMHL[HH]A\A]HH[]A\A]fDUHHHSHHdH%(HD$1[Ht0HHHH$ H\$dH3%(u&H[]1H5~H迢 ûAWAVIAUATEUHSHxdH%(HD$h1HZpLjpI9EL|$ AHL9HCtEt1HH@LHSHH`hHC0HPEH>uD$Ld 1ɺEH5K1DL$fD0AHL$hdH3 %(DHx[]A\A]A^A_@HHt$蓂AIMLxI9tLT$MwpMtYI~HHHLT$yLT$ELHHI!DLT$GLT$IGxLxI9u(MME1M9uDM?M9IGHxG\tDL$L\$FL\$DL$L9pXt L9uIGHPHzHH8HDL$L\$HT$HT$L\$DL$"EHDL$HL\$I!DTL\$DL$BLb 1ɺ`H5IE1!Lab 1ɺ@H5HyE1D$L5b 1ɺBfIMI9ELt$ AHL9HCtEtAHH@LDL$DL$HtlHHDL$]HCDL$0HPEHDL$1DL$uLqa 1ɺoH5GE1LJa 1ɺjH5GbDL$L!a 1ɺMH5G17E1L` 1ɺlՉD$L` 1ɺO`D$L` 1ɺQIDL$L` 1ɺ\1L` 1ɺ^H5-G躿E18ff.fAUIATIHULSHH(dH%(HD$1H4$誏HD$HHdBHڅu]DHAAÅtHHGHT$LLј HL$dH3 %(u{H([]A\A]fHHRHt$H<$" L_ 11H5)F豾Lq_ 1ɺ1H5E臾s轵ff.fAUIATIHULSHH(dH%(HD$1H4$zHD$HH4AHڅu]DH1AAÅtKHGHT$LL褗 HL$dH3 %(u~H([]A\A]DHHRHt$H<$ Lk^ 11H5D聽LA^ 1ɺ1H5DWp荴ff.fHHHIG麖 f.HIdH%(HD$1HAHt H@Hu31H5L Ht$dH34%(u"HH@8HLH$ݕ ֳfDHIdH%(HD$1HAHt H@Hu31H5AL肚 Ht$dH34%(u"HH@8HLH$] VfDHIdH%(HD$1HAhHt,H@HLH$ Ht$dH34%(u!H@1H5Lߙ HIdH%(HD$1HAXHt,H@HLH$詔 Ht$dH34%(u!H@1H5.Lo sUHSHHdH%(HD$1HAH@uSu.1H5H Ht$dH34%(uAH[]ÐHHHH$ ɐHT>HH@H@ұfAUMATIUHHSHHIHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH.PHt!HMHL[HH]A\A]ۣHH[]A\A]ffDAUMATIUHHSHHnLHt!HMHL[HH]A\A]{HH[]A\A]fDAUMATIUHHSHH.MHt!HMHL[HH]A\A]HH[]A\A]fDAUMATIUHHSHHNMHt!HMHL[HH]A\A]黢HH[]A\A]FfDAUMATIUHHSHHKHt!HMHL[HH]A\A][HH[]A\A]fDUHSHH(dH%(HD$1HAH@H)raH*s:(HHL$HH HD$KHT$dH3%(u]H([]@HnH5H HLD$H4$HxG;LD$H4$HH@H@m蹮fUHSHH(dH%(HD$1HAH@H)raH*s:,HHL$HH HD${HT$dH3%(u]H([]@HmH5H HLD$H4$Hxw:LD$H4$HH@H@mfUHHHSHHdH%(HD$15MHt0HHHH$螏 H\$dH3%(u&H[]1H5H_ cUISHHEAt$ D\$(Eɋl$0Dȃt$8DEDȃED\$@DEDȃDEDȃt$PDDDȃ EDEDȃ@DEȋuk%H 6HELos6H5t6LDH6H566HEWLQHt$XRL H HHtu%HH[]1Ln6H506fDH5R=HY HH[]ff.@HHH AH5!6WLHVH56RH&t6Q` H(ff.@uFu^HW6@ǀt 6u+H uHJHH1f.HY6HHHH@HDH6AVfAUIATUHSLH@dH%(H$81H$H,$Lt$`)D$@)D$0HD$PLt$HLD$ILL$LEH|$`HH$xHD$H$pHD$ HHT$(Ht/HK@ugH;@HtfDMI<$IL$H1茯 H$8dH3%(H@[]A\A]A^DHɎ7HH$HHC`HB7uDMt6L#@HD$(H9HC`Ht H@0HD$@HC@HtjHD$HHD$0HD$( fDHLŮ DH<H7H$HC`H7D?fDo oS$A}Mff.fUHSH`6H@HHH) t ;uH[]@USHhdH%(HD$X1M݋7H$L$L$Ht$h$HZLDMɉ-7LDHHT$HDMHL$LDMLD$ LDЋ$LL$(H\$0D$H$L\$8D$LLT$@HtHR HT$XdH3%(uHh[]&fD7ÐAWAVAUATUSHhHt$T$H|$H|$ dH%(HD$X11|$,Ll$8Ld$0L|$HLt$@Ң|$(H覢HHMT$MRHSHt$0VAWAVHt$8H|$PwH0HL$XdH3 %(uHh[]A\A]A^A_Of.DHGHWpA AHp0HGH@PH8fHGHIHWpHp0HGH@PH8*f.SHH0诡H[馡fDAUHATUHLSHdH%(HD$1HLd$@Ll$H H$Pt2EHL$dH3 %(H[]A\A]DukHI$HpIuIu@HtH;PtyH9Pu[EDLO 1ɺuH5h1蝮rEYI<$誖 EYff.FuG3u*5f.HdSHH'}t [Lg1H5\d"[ff.AUIATIUHSH(dH%(HD$1褸Åt&<<tD<<Ht <<EHL$dH3 %(7H([]A\A]HL$ LL$LLD$H5H<<su1<<1H5cL?t <<|$ vJ;<;<HtEMMAD$3A;<tO;<,@uD$ w tXLAf1ɺ1H5b诨f.1H5bL菼Y;<ÉM;<|$C覟fDATI1H5g~ UHSWTLRHEXH5hLHPH1RÅHEpHPHE3t-H5bL1dRÅ[]A\fDH5LbL17RÅuLH 1ɺ]1H5a蠧fDL_H 11ɺYH5au[]A\fD1L/H 1ɺZH5aG[]A\L H 1ɺ_1H5Ya5f.HGHWpA E1Hp0HGH@PH8DUHHSHĞHHtlH7HHCHHC H=HC(HC0HtHKLK(L/v 11H5`[HH[]ÐLG 1ɺ1H5i`/f.LHdtHGH@(fDHH=cff.fATUSA@LLHl$ Ht$(It/AP8H{DCLHHL[1]A\{IxHGPLOHHLzvuLE 1ɺH5b1DI@LcH5bLHH1[1]A\DLE 1ɺH5Yb蹤[1]A\fAUIATIUSHHdH%(HD$1LtHW8H5L@GŅHH5 LHŅtFCP1E1LLHsLH$CPHL$dH3 %(H[]A\A]HCLHXHJHLpbSIV1H5qạXZHCLHXHIHLaISPКATUHSDOLA1La1ɺ+H5`VHEH@PH8DM8La113H5`AEL1L%`t?fDAM1ɺ6H5`1HH l9]Lw[L]1ɺ:H5K`1A\颢fu88LL`1ɺ0IH5`1tYHk1SHt!5<t 5<[D1HH5 `4< u 4<[Ð1H5^HDGL;FLN89O8ATUSLA8uqLA9udIIIPD_PHYH9ZuNLT@I0DI9t>A<u*A<u#ILITHHYH9Zu ZD;Yt[1]A\1IHHH4vtAD$$E$1AD$PEPELuDD;]Ls7HH@HHƒ:uI$HzHtA;]Lr[]A\UHH5HSHOCt H[]fHFL*_AIH5]1?H[]fDUHH5 ^SHHHOLHHEHt?{Lvs81HdHH FtFHHH[H]]vfDL@ 1ɺcH59]號H1[]LY@ 1ɺgH5]qff.@ATIUHHSGHHtGH7HM1HC Ln 1H5\Lc(HkH[]A\@L? 1ɺ1H5|\מDHH="VfDHH=\6fDHD11Le]H5d]PL&11H5H]H+ff.SHH0/H[&fDAWHMAVIAUILATUSH(HT$Hl$`Ld$hdH%(HD$1{ HD$@t@AEHHEHL$dH3 %(#H([]A\A]A^A_MI!1ҋHTIGHHDHHHHD$H8H9wGH_ AEHD$I$mDL= 1ɺrH5\1LLHuLHD$HD$H0`IIDHT$1IL.]1RH5[~AV舜HD$ HHXZOfDAEHPI$薓fDAWAVAUATUHSHH5P[HH(dH%(HD$1Ld$L@iHEHt$HxPIHkHH5$= H5?ADžH5 HkAE1H5KHQA LH51Hw?AHEE/HxPHt$YHD$HHH5G; H>ADž"H5,H@SLH5H>AHEEyHxPHt$IHHEHHhH@L^UPLL$ Rf.AHEHHhH@HLE[UIH5wY1a_AXHL$dH3 %(DH([]A\A]A^A_HEHHhH@@HLX[IUDLH5 H=AHEEHxPHt$IHHEHHhH?Ls[UPLL$ Bf.HD$'fHEHHhH?LgZUPLL$ H5`X1E1BY^HEHE1L`HE?DATL[H5XP1XZHhHH?HLdZIURfDE1LD$1LLHADžLHrdADžA@HhHH>HLd[IUfDHhHH\>HL4ZIUfDHEHHhH(>HLxZIUvf.L8 1ɺ1H5V迗\f.Ly8 1ɺ1H5V菗,HEHHhH=LYUPLL$ 蘎HGHWA E1Hp0HBPH8 fHGHWA AHp0HBPH8fDHGIHWHHxPHr0HH?Kff.AVHMAUILATUSHdH%(HD$1HLd$@Hl$Hr tnH$@8uTMHpHx~ AEH$HPI$H@HEHL$dH3 %(uvH[]A\A]A^fAEАL6 1ɺH5U1Hp Hx~ AEH$HPI$H@ HEx@SHGHwTH@PH851Lk +IH5T1qz1LT,IH5]T1BHCH 1L]T.AH5)T1L11LAT/H5SHlL 31 LEȺ111LTH5S謔L113H5S[銔f.ATIH8_ULHS3gt'H_LHgÅtg[]A\LW1H5+S1L4 1ɺH5 S[]A\f.1LWH5R輓[]A\DAWAVAUIATIUSH(D &<dH%(HD$1EMtq&< _&<t7!AES&<H|$dH3<%(&H([]A\A]A^A_1ҾLa^H8L` H-6L=2 Mu&@Mt$A>Md$MA<$tL m]1ɺ1LVH5Q謒f.HL$ LL$%<LD$H5C]膥h%< HQ6L5]HfD9D$ w u(D$9CwC "%<HH9DHsLl 1ɿM1H5Q_AXH-q6$< $<H6L%Z\Љ$<HH91_AXHT$H5  H\"ÅID$HL`H%HL)HIATHT$H5 H"Å|$A$ID$HHXID$HHhH%HLHUII1H5=~XZ9ID$HL`H$HLFIATzaID$HHhH$CLGUPLL$@ID$HL`H$HL`GIAT|uff.AWAVAUATIUHH5U SHHHHPH1l(I$H5T HH@HPH1C(ÅaI$H5g=H1 (ÅAt$THS H1H#ÅE$AAfDbH5T=HH1'Å E$A6AA$M$IM9IE1A}<EuH!ÅbAH5<H1D-'ÅHk!AE%LF11ۺH5;o|&DL1 1ɺ1H5`;G|H[]A\A]A^A_fDL 1ɺH5(;1 |LEH5:11{L 1ɺ1H5:{sf.IELxXLHHLE11۹H5:x{,L9 1ɺ1H5h:O{f.LAE3f.1҃H5-;H1w%ÅL 1ɺ1H59zIEH5:HHPH1'%Å`HH5H1%ÅMmM9,AUH5:H1$ÅuL 1ɺ1H5M94zL 1ɺ1H5 9zfH59H1_$ÅL 1ɺ1H58yxL 1ɺ1H58yRLb 1ɺ1H58xy,L< 1ɺ1H5k8RyL 1ɺ1H5E8,ySHHCKt [L<1H57x[ff.AWAVAUIATIUH-^6SL}@HHpHHHELHk(HC EIHC_AHC0t HtHKHL*LK(LG 119H5&7H xI9c <AHD[]A\A]A^A_fDI$1L H56wE1@D$ Lm 117H56wDL$ f.fz <SHLo <t[HHR fHH9HA<Iu1ۅu[1LAH5Bw[1 L <H1H B0fDHyAH@uZD[HGH AB HЉ?HPH9uff.foHG?LGoNH5AODH? HL9uGGfDAVLw AUE1ATLg@UH-AS1A6HkHH)HDڅAHIM9u҉[]A\A]A^UHG=SH_ H @HH9t;0tH1[]ÐHhH}@HHDBtHH9uH[]ÐSf HGtYHLK L@H !B!HHHHHHHHHH)HH)AGL9u˸[@oH GoNObf2fHHWH3H3VH uHGHWH3FH3VH t 1fAWHAVAUATUSHH&veH-?IAE1Lm@D}DIcHHHLEoHHJ-L9uH[]A\A]A^A_fHt1L>H5:?sH1[]A\A]A^A_HH1-tFHcȃHVu t\1L>H5>Hs1HÐ1LZ>H5>s1HDHfH1@-tHcȃHVu t 1f1IfUH(SH٦ HHtI(HH!t HH[]L9 1ɺ1H5=OrDLӧ 1H5=$rfF$G$FPGPf.dHt$H|$ ff.fSHHDt [L=1AH5}=q[ff.SH#tq<t c<[DHߺH5G<*[7<fSH iHHtDH\7L O1ɺcHC L@ H5<1LK(HCapH[L 1ɺ]1H5<pf.AWIAVEAUMATIUSHHT$誙HT$HHHtHH詨Mt A<$MtAuH@LEus^L$hT$X>D$`jt(HeN MtLHDHH[]A\A]A^A_T$PDHqLM 1ɺ}H5;eo@LHUL 1ɺwH5];.o fHد L 1ɺH5 ;n@HJL<H5:nHIL<1ɺH5:n@HIL<1ɺH5x:Inb@L  1ɺtH5P:!nH1FA\L 1ɺzH5 :mL 1ɺH59mL 1ɺH59m|@La 1ɺq1H59wmfAWHAVAUMATIUH1SHhHt$ dH%(H\$X1HjHE1RAQ$ RD$1~H HHMHD$ DEdH틌$…tEMHD$ DEI|$Hwo HOHFP1HAO$AA)LHHHD$HFXH'"HD$H @fHL$8HT$Ld$1L|$PLt$HHT$(ILl$@@HD$PHtZMMLLHH@H9l$8uHT$@H;T$t0HL$HIHIA[@t H;T$Ht$HtH9uHl$HLd$HMl$Lt$PIEM}AD$ @[MIE@Y@II(Hb5IG H@@Ht HЅID$Hx蕅I1ɺPL9Aw(H571j^_L 1ɺG1H56jH=H\$XdH3%(Hh[]A\A]A^A_H8Ht#HLatHD$ p@HD$EtkqHD$ DEYHH?ML 1ɺ!1H5"6i5fH;T$(3@HHD$GL+AG( fH*H=#H€H=#H€H@PH5ܷH8a&IHL 1ɺ1H585i%IG \H*H$H%|AD$@HT$VfI|$HT$HD$HGH@X9f.L) 1ɺ1H5s41=hHD$I<$IT$Lѐ AD$BI<$IT$L AD$I<$IT$L AD$ID$Hx HMO(1PL&6I<$IT$LS  AD$I<$IT$L 0AD$hL 1ɺH5,3fIuI<$MD$LHL$ ~eAD$L 1ɺH52fI<$IT$LN AD$L< 1ɺH52TfuL 1ɺH5_20fQI<$IT$Lʊ AD$KL 1ɺH52eL 1ɺH51e\L{ 1ɺH51eLW 1ɺH51oef.AWIAVIHAUATIULSIHHH$0H$HHL$8DD$dL$8HT$@HD$hdH%(H$1MHDŽ$HDŽ$D$|HDŽ$HDŽ$HD!HD$0HNDL$d E;LE1MLH$jjjjH IH1D$EMt $AEH$D$`E1HD$ H$HD$H$HD$H$HD$HD$|HD$HH$HD$PH$HD$(HD$XD$`MELL$ LD$LLHL$HT$7IHt HH HHHD$(L$MtH$tHt$8LZHT$0HJ t#HA@HqLЅdHT$0HJ HAPHNt$PI|$IL$I$t$`L$LD$8Ht$X_AXWt$`T$|HD$@u t uaHt$@MHtkHH HtWH|Lv1IH5^.1(bE1$$MJ Ht$@@L$`HD$@$@I|$;}L.IH5-1aALDL$4DL$D$duTH$dH3%(DH[]A\A]A^A_ 0ef.DL$DL$tHD$hL 1ɺH5(-1`E1`@Hh{L/IL 1ɺ1H5,DL$`DL$1ɺD$L9 H5,]`DL$L 1ɺ~H5`,1`E1L 1ɺ1H5<,`E1tL 1ɺ1H5,_E19LBVff.USHxdH%(HD$h1uHu2ǃHL$hdH3 %(Hx[]1Ҿt#uHl$PH8nu<1L.1ɺH57+_ǃ|1HL$HT$HLD$ H5T Qu|$tv8|$w{Uf.AUI0ATIUHSHH? L7.HHL HEXH%sMHHkHCH"CHC(HLH5迲H[]A\A]H0siHHHCHCHHCH HC(fHZHvHHCmfDL- 1H5)d]H1[]A\A]AWAVAUATUHSHLb4$H$LdH%(H$1D$HߋuLID$P1L01HL]AH$8HEH8AD$^LIHL(M11t H5({\DEE11LbPBHL$P@ljD$HHL$L1DT$HL$H?H<AbHHuDAJ}R8OA}MH tH{<HDHLP PH$H5'P1R [H A:@u1L&HrH@ H 8u,HHH@H HH8tLM( LZ,H5='1[E1H$dH3%(DH[]A\A]A^A_H'LIHL=uj L*Iz@HcHT$1LLHA…X|$ZDmEu H} E$D} 1Hl$ Ht$0DT$D$H$H$0HD$@HHD$0Hg&HD$81HHL诛DT$HH¾HDT$\KHt.1HL$HT$HLD$H5# LDT$HH5%I1t$8K 1L+]Y^_HL$L+1ɺ H5`%1*YAO8LA}H qH9HDHMPHf LM PRx H5$1XH E1@DXGD$H-tqH69O8IgLA}HMHEHLtM PH H5s$P1R} 6XH D$DFA…A<$LA}MLM HDH PH^PSD;|$r D$;D$ HDT$MDT$HtDT$H1ɺI D$L})H5#PH#AWAUP1SLL$`gWH0HDT$ $D$\$LqH L)SI1H5C#WXZD$@L' H5 #VE1fDL$ L/(L:qp L'IwLqLb)1ɺ IH5"1eVD$XM 1L&H5_"+VALL$0Lĥ 1ɺ; H50"UL$L'1ɺ D;l$  HKHtH1ɺI D$L'H5!PH "AWAUP1SLL$`zUH0HL@HHAE11dH%(HD$81Hj1jjVHH Ht:HJ($uHT$8dH3%(u>HHfDT$1L 1ɺH5 T1L;t@HH?1H;H5 Gt;HD ;A~H1-jLj'H5h 9TX1=K;ZfAWEL'AVIAUATAUSHH$L$L$H|$0H$H\$ Ll$(dH%(H$1EILEH5Ld$R@SMLH$HLjAWDL$,H U-LKFIHtxH?7Ld$0bDI}wJuLELLb HHLjjAWDL$,LD$0HL$@HT$8zH Eu!HH3HuH|$(HǠufAHL$xdH3 %(DHĈ[]A\A]A^A_D$ LE 1ɺEH51[RDL$ @HI~HjjAWDL$,LD$0HL$@HT$8H dD$ L 1ɺafD1ɺTD$ L H5 QDL$ #Iff.AWMAVEAUIATIUHSH8dH%(HD$(1LT$pL\$xD$$H:HӸHt8t4HD$$MELP$1HLPASARH 1L 1ɺH5= Q1HL$(dH3 %(H8[]A\A]A^A_@HD$$1HD$P$PASL\$(ARLT$(XH LT$L\$uVL$$pID$L\$LT$HLT$L\$u1T$$fD?fDt$$M1HSELLPASL\$(ARLT$(H uD$$LT$L\$*Gf.SHtHSXH%r[ÐsHa[HÐSHGPH1HWHHHHxZ HtHH[^fD1L/ 1ɺH5{GO1[AWIAVEAUAATEUHS1HH?HT$dAG\ ueEtP LeڃHEEڋu؀EE؉؃ EEH[]A\A]A^A_H|$t LHHu@LPtIGXH%rɩ@uIH!ڃ EUfAWAVAUAATIUHSHHDO,Ht$dH%(H$1HB HDE]HGLGHHLHUPfHDŽ$)D$`oJhoRx)D$p)L$@)T$PEH8HoHH5B$ L)\$`obHT$@)d$pFZ IHHEPIVHHI<$HW HHI|$E1E1jHjHT$(RLH AƅDD$EudAH$dH3 %(DHĘ[]A\A]A^A_fH@IF HHDfL?I|$E1E11HH8T$,t$(H|$eAƅAL$,WHfAUIٹPL1 H5MLIt$XLZLHƸGAƅL 1ɺ" 1H5KL 1ɺ 1H5E1K1ɺ E1LR H5vKL9 1ɺ 1H5OK\f.HH5_D$4L PDL$81K^_BBfSLZIHBIS H@PLR8MtEIHG1ACt APLA+SAP(HHOPA@$)HPVHWH7AH [L0LtJ IH51iJ1[DAUIHATIUHLSH蒾HtMHHH_THt2HrOHHtRtHLY~ HH[]A\A]1@L 1ɺ1H51ILPdL1ɺIH51If.ATIUHSHHt uAHMXH"r6H!r/Ht:AT$uH[]H A\Hf1[]A\fH%r@tf.AWE1I1AVAUATUSHHHW8 t$lH$IIdH%(H$1HAHDŽ$H %j j1jPHD$HH H]D$Eu@E1H|$(H$dH3%(DH[]A\A]A^A_Lt$(LӀLHD$p6HŋD$lD$jtD$ED$lD$k Ht D$l0S H$D$DE1HD$XH$HD$PH$HD$HH$HD$`L|$8LL$XLD$PLHL$HHT$`H|$(IH$HD$jt)L=jHLAAEE  HH=AA|$kE+EtHH=B€HD$8E111HDŽ$ HP8jjHIjH I%A 1PHD$0H H H$11HD$ H$L$HD$H$L$HD$H$L$HD$0LL$LD$HLHT$ H|$!HH$H HH=q€uZH$HILL$01LLL$H5h8H@\@HƹH= uNH$H1LH5 LY8u$$u1HH|$H$ H=tHAAEEHH=€`H=HAAEET$DtDH$H= Ht"H=HD$DML|$8D$lt D$DAf.$$}V$$b;1H=H$u HHL$HHL%\ ]H$HXtv S H$H=:H$u HHL$HHLM] H$Hp8Ht#H=AAEE)Hu H$@H=HDŽ$t HHHD$8E111 HP8jjHIjH I%A 1PH HH]H$H1L$L$HHD$H$MLD$ HL$H$Ht'1H$H$H5r 4zL|$8H1ɿLH5 IW8HIH I%A кP1lAAXHAYHxt H$LXt$pLSIH5K 1AY^fD蓦5 H= L$H$H$HDŽ$&s HD$H H|$H$Lsj SH$1E1Lt$8z^fDDHrH@H8AtDLWHATI1LH5c /@XZH$AD;brHD$8E111 HP8jjHIjH I%A 1PIH5 1>LH|$q @HD$8HLX1HP8HIH I%A кPH5P 1>[A\fL 1ɺDH5 =H q H$%@L 1ɺWH5 =Hp H$ @1Lg 1ɺAH5 =H$f1L7 1ɺTH5 O=H$fHhjE11j11 j$PD$H HHlHT$LD$ 1HHL$MH$H$Hd [H$x0@8HHo LY 1ɺ1H5L|$8j< DHD$8HL1HP8HIH I%A кPDr(EHB08AH|$8RLIH5 1;L 1ɺ1H5L|$8;Hn EDL|$8I_8LGRL 1H5HIHH  1RZSE;AZHA[Yn H$LQt$pLISD$E#LQHL_t$xIH51:AXAYWL 1ɺ1H5:fDH|$m H$ffH=$ HAAEE9Hg,HE\Ht$pH$0H$I 11H$H$L$? H$Ht 苭L$(A<$D$l  H=+Ht8 H=HtH=H}CHHLHEE1OHt$xI1L4SH56U9H LLl$x H|$k H$L 1ɺH58@La 1ɺ|H5L|$8t8L,OHL4It$xxL|$8L 1ɺH5X1"8H|$8k fD1ɺE1L H57fL|$8LNL1ɺ,IH517H fL\ 1ɺ$1H5L|$8m7L1 1ɺ(H5xL|$8D7Hl HTj LMHLw It$xD$l 8HHD@1H$ HH= H111,@HHH$HP0BRHH H H%H HC81H߃4 @RH|$L|$8[i H|$L|$8W H$LLt$pLIS&L|$8H$LLt$pLL ISL|$8LyLL IH5150L|$8LQ 1ɺ@L> 1ɺ1H5L|$8O5LwH|$]h LKHL It$x SIH5pAU1U74H H`+L|$8fDAT1A1UAL&SkHVH5 3Y^]HtyHHstDH tuIHAq1ATLZ 1H5 z3XZH[]A\fH@11L 1ɺnH5a -3[]A\fDAUAIE1AT11ҿUSHjjjV1bH HtIHH1 mIHtL1$LLH)@HH[]A\A]Ð1Lg 1ɺH5 1}2H[]A\A]AWEAVEAUIATUHSHHHFPHVHHL$ LH< HH{LHIeHHEEHt$hLHt$ht$hL$,H Ņt"H{Lf H[]A\A]A^A_DL 1ɺ1H5 1DLY 1ɺ1H5 1m1L1 1ɺ1H5{ G1hfAWAVAUATUSHHH|$dH%(HD$x1HD$0HD$8LHD$HLl$@jE11jE1L jjHL$07H 1ɺHL HDd$@E{L$LHD$(E1L|$8H$HD$ Lt$0HD$H $HT$LMMH~Ll$0IMtHi"HLH tGMuHJHt$H|$[d HL$xdH3 %(D'HĈ[]A\A]A^A_fAHjE1E1j1L jjHL$0H HHT$@t D$LLK 1ɺ1H5 E1^/7f1ɺE1L H5] ./fL 1ɺ1H53 .L 1ɺ@H5 1E1.&AVAUATUHSHAMMX D9w@HDHrfÅunLE 1ɺA1H5 [.PfHML:1PHH5] 1ATAV#.H HHeÅt[]A\A]A^fD1L 1ɺOH5 -[]A\A]A^ff.ATIHUHSHI<$HHLe 1ɺ HtoIHCPLKHHLC[@tVHt"11LHk~t[]A\DL 1ɺ 1H5; -[1]A\HAWAVAUATIUHSHHXHt$L$dH%(H$H1BpD$XG,H?D$D` HIH(1L<$I9l$(L5NAEM HFAWH5 AVIL 1 ;,HEX^_H2JH-iH0H<$HEPHUHH $H;H~6 IH H$H;H#IHH|$H5HH 1HAH$HdH3%(D HX[]A\A]A^A_fDE[HHHt$H;1HIIHt4IFH@rED$$EA>At$IF@4IVHt$H;1iHtdIVBHtOI~6EHI+EHL[AVI 1H5 n*XZAD$HEPHUH1H;H4 IHC E\  Hp?HH$.E1I9l$(ImH{AAL$H$HEMED$ AT$E1LDHEPHDT$H@`% H H$AD\$H<$D\$ADT$E11HLLARAUASH|$8":HD$XH HH|$8'IEHEXCH2sC,H-fHvnH<$H{LHHD$0L9H $HAHD$Hl$HHl$HHDHEHT$ HD$(fDI}gIHMDM~IG H@H LLHD$I}CHLt$0 H5w t$0P1LL$(<(IG H H@XHtIVLHJP1H9Ѕ MMtD[(EgC(LuBLh IH5 1'L薼LLHIH* MIL9Ll$MIfDMmM9IEL;uHx-IUH;HHHRHtIEHxLHHIIEHPuL 1ɺz H5 & @Ht$H;1HnH%HEXH-HZ RHEXH0H;H@^fH"HLHL}PHD$HH HD$AL$E1HH0ED$ H{H$HD$(LT$fD$ IB@^U LT$MNHH1uH1! Lp H5 %ZLY袺Ht$LLIHLT$I8fIN H;H$)$H56 H)B0)$0HD)$)$)$ HDŽ$@AoOhAoGxHB@)$)$o)$oXI@)$H)$HD)$H . o )$ oh)$01 HD$H H;H$H  H5X s1 HD$0HIVHIH H;. HD$8HZIVHIH + H;. IHCH;L1zIHD$ AT$LHD$ HEPH@`% HH H$ɉL$HTHAAD$(PAUL$`QHT$(DHt$XH|$8d4H IHC,6HLT$>H5 ILi 1H e#LT$Ht$L#ZnHEPAT$1LHH@`% H H$L$HALAD$(PAUL$ QHT$PDH|$83H IHjC,iH]=H5 IL 1e "Ht$(LiY}LZ 1ɺg H5 r"fE1L=@;MHHt$E1LHHHP:Aƅ HǥHt$E1LHH AƅRL 1ɺ 1H5 !2@HpH@HH<$HEXH% @ L$LHHL$0L9^D@qHt$8HHmAƅRL 1ɺ1H55 !b@L 1ɺ H5 1E1 5Ll$LK;L } IH5 1 C(IHtE1LHH(IHtE1LHH[SIHET$EIhAULE1[IEH@tcu\IHtPJT0HtFIHJD0H@XHtt"E1LHHfAE;}LDL4@IIL8dHPHHJXHt Ds,tIEH@ 4E1@uYLHH# LԿ 1ɺ 1H5 f.L 1ɺDH蠳IIJT0K,I}$9 L IH5 1mIEIUH@P1Bt AEL+BAE(Au$H|$8)HU3AE8AELt$Mm9CƉD$L;l$0VH<$Hl$HHEXH%sHt$8HHKAƅ HEXH0 HUHH={PHuz_H]HuhL|$H;1HLHtNLHL@LHLHAƅu.L 1ɺ51H5a -t$X1҃H|$8C0tPEY tJLHL9t7Lt$IEE1LLHHPwMmI9uD$DC,@IG(HD$fkLHHIIIhHt3EL$E:,LHHIhIDdIHED$ELHHIIL 1ɺ H5 DHt$8LLHzLn 1ɺ H5 I}6HL' t$I1 H5| H[]aL 1ɺ H5P !<@L 1ɺ 1H5+ XfL 1ɺ H5 @HE1M5HL t$I1 H5 AXAYDDExMt@L9 1ɺl H5 QL 1ɺ 1H5d 0KHНHHH@L 1ɺ H5 @1ɺ E1L H5 fH<$Ht$LHHLNAƅ! H(IH HpXH;Ht 虍IH IupH;HNzHH IEXAu$H@PDAD$LuHHL$HL$ EMTH|$8LLAZO fHEXD$C,@La 1ɺ H5 y@HBHt$LHIH\AƅHt$8HHqAƅfL 1ɺ 1H59 fHEXL 1ɺ0 H5 cL 1ɺ H5 @HPH@^u>H<$H0H$Ht$H;1HH[ HEXH0HH@^t&H<$Ht$8HH膸AƅHEXAft$t$XHt$XH$;t$X$L 1ɺ H5 @Li 1ɺ 1H5 f.Ht$LHHL fAƅlAD$^E[THFHHt$LHHPpLuKAƅ HIE[+ H H;H HIH IvpH;HKIH IvpH;1ډIH ENTH|$8LLHL LLM9Lt$IWE1LLH:{M?M9uUDL $ H5 yfH;H HH]HH|$8H1JNLr 1ɺ H5 LS 1ɺ L9 1ɺ1H5 O1ɺFAL H5W (A1HHD$pHD$xD$HD$\HHD$ 9HD$HH$E1E11HD$(Hƿ jjjjHL$(H IHL$$tZLjE1E1j1ҿ jjHL$(Ht$HƢH IH@$$1LHL$hLT$(HT$`LL$xLD$p5Ht$pLT$(H9H=aH|$xH1HT$\LT$(H5 LT$(T$\9T$HLT$8Hs+H u HDȉT$0HL$(-L$D$L L H5| QHL$0EQT$@R$PH2 LD1!H LT$8L@Ht$H|$ QF D$;D$\~I~z,I~In,HLN AWI H5 1AYAZHIVpH;1H HKuqH*HHEXHEPLMHLLT$Ht$HLlLT$11LL@bLѱ 1ɺV H5 tHl+ L IH5 1AD$G1ɺ ALa H5 LI 1ɺ2 H5 aD$YL 1ɺ1H5b .L 1ɺ1H5< iL̰ 1ɺ5 H5 oL 1ɺ 1H5 HA* L IHpH2HZHfFHEPLMHLHt$(HLzyHL$1LLP`L 1ɺs H5( L 1ɺ7 1H5 ^I~U)HIJ)HL IAV Ld 1ɺ: 1H5 zIFH@NL1 1ɺ H5x IL 1ɺ*1H5W #L 1ɺR H5. Ht$8HHZAƅL 1ɺ$1H5  LT$(L} 1ɺH5 1 LT$(qH(L ) IH5 1Z L# 1ɺ]L 1ɺH5W ( IFH@L 1ɺE 1H5.  LT$(L 1ɺ7L 1ɺJ H5 IL 1ɺo H5 %LT$(LY 1ɺ LF 1ɺ. 1H5 \ LT$(L 1ɺL 1ɺ 1H5R  H|$8LBDLͬ 1ɺ8 1H5  L 1ɺ< 1H5  ^H@&L  IH5 1 LR 1ɺ L? 1ɺb 1H5 U L 1ɺ 1H5c / L 1 H5A 1 Lϫ 1ɺ1H5  L 1ɺ 1H5  ,L~ 1ɺ 1H5  LX 1ɺ H5 p L4 1ɺ 1H5~ J DAWAVAUATUSHH $HH|$ LIMHt$H$HL$(dH%(H$1TDHHHJ 1 HHH HD$PH-p HD$H$HD$@%MwHLAAEEtVHIHuAHH$dH3%(DH[]A\A]A^A_@A$DT$ D$HTHHD$8)HD$01I H$H $DEDT$ D$E111jjjPDL$hHt$8 H D$HIEDL$PEL8LL 1PH_ L PH5\ 1+XZ@ML 1EMyH5" L 1ɺ1H5 uD1E1LR H5 T@HDT$LALI@@L$lT$hLH$L$HT$ !4$L$PLF IH5v 1QT$RAW.H HT$0LH|$8HT$0IuPLLDIIWH3FhH3VpH vIGIWH3FxH3H ZH|$LDT$LH?LL|$@ADT$ L I}PLDT$ HI|HD$D$PLDT$ LH$ HH5i HT$I1L RY^DT$ H|$(D$PHL$(Ht$E1LH|$ D$iM1EֺL H5 L38$IH lH.HDHE1PH\ Lv PH5 1RJH L 1ɺ1H5T E%L D$IIEPHML ELL$H5 1_LAXHt$H|$ 1LcD$M1EֺLS fAWAVAUIATIUSHHHRHH?H4$dH%(HD$x1ID$PH HHND[,EH;LLSxIHHH{HE1jE1HjLt$(AV讯H Ņl$M#u?HL$xdH3 %(LHĈ[]A\A]A^A_fHCHGbH{E1E11LLT$,t$(H<$Ņk|$s,AD$Y iIl$H_HHNH=5H0H4$MNMF1LHŅ L 1ɺ 1H5 fDAT$tAL$x<Ht$@HE1E1Q11R1jޔH tDT$@El$|L 1ɺ1H5; 1VLɢ 1ɺ1H5 0f.L 1ɺ1H5 f.L(HLP AWI H5 1kHCZLYHGHGŅD$@l$,9\$(LL$ $U1SL$I1LH H5 QT$RH )H D$4LW PDL$8H5 1AXAYDLY 1ɺ 1H5 oAD$xHEL$tL PAWAVAUAATIUHSHHXdH%(HD$H1HBX t 0H-H0E<1LHHdH LHHGH 5LHH*ID$XH%j@H0EDS Eu C,aL藾t6M$M$M9t!IW1HHM?M9uߋS +AD$[I$L蟿HHHP$L 1ɺ DH ǟ LHH#AD$\*C C(A$M$M$C(M9uM6M9IFL9uHPHHuω$LŞ 1ɺr -fE{0%D{,EM$I$HD$L9bIHt Ds(E IHt1HH0dIHt1HH-IhHt-IG@t#D[ HHEAE6IHt-IG@ t#DS HHEAEIHt7HBXH-r H4cs H߅HAEZbEOLE1EuT IGH@t3u,IHt JTHt1HH 'AE9wLDL @IILȃ8uHPHtK,tHID$XsHJXHHL $HL $M$L 1ɺ H5 1D$Ht$HdH34%(D^HX[]A\A]A^A_DC Et!IWhHtHHM?L;|$AI$t dID$XH0L~LMAF^1LHH般t8LHHqt!L蕏LHHH4Le 1ɺO fHH0$L. 1ɺ f{(M$M$M9uffDM6M9TIFHPB^tC,DHH)C,L 1ɺX H5 1E1L_}1HHHHPWL7}1HHH3+$L1 1ɺD L-LHHH$L 1ɺ_ bfDLLHHHcDS EbID$X@cL貍LHHHQgID$X8AD$Y M$M$C0M9t6IGHxIGu-HP1HHM?M9uC0qHxEHɉ$L 1ɺS ^$L 1ɺ H$Lʘ 1ɺ[ 2LD$ŒH;LH$lHsHHHhLHHR$Lg 1ɺ LD$\H;LHkHHHIHdEC$f)D$)D$ )D$0D$D$-LzHp LzHL$LHH$L 1ɺ f$L 1ɺ $Lp 1ɺB $LZ 1ɺ| $LD 1ɺ $L. 1ɺ $L 1ɺ C($L 1ɺ ^$L 1ɺ H$Lʖ 1ɺ 2$L 1ɺ $L 1ɺ LHH$$Lr 1ɺ L_ 1ɺ H5 wD$$L4 1ɺ L! 1ɺ H5h 9D$kff.AWAVIHAUIATAUSHHdH%(HD$x1{E]H Hz PH Ls EH5 HDDH IRL Ⱥ1]A_C] tH5n 1AAF(AmAF AD$AF$}IH!H56HHzHLL11LHHJMHEU1E<I>HhHD$HAsAAYEMLd$XHD$XEHED$HD$HD$pHD$HD$hHD$HD$`HD$ 1HLsIHL_HHtLoIHtLD$HL$HHT$ I>HD$p8tHD$HtLHtIFLHG) HVIVHGHGH\DLM 1ɺH5 eL. 1ɺ1H5x DE1L@AiXAHt$$HOHD$XI~EHD$pD$Ld$XHD$HD$`Ll$hHD$1HLHHLD$I>LHT$HjHt$`>tHD$p8uI~HT$hH@H두HSXH$H%DfHXA~uHhHt$$H AHDT$JDT$LDT$DT$H\$xdH3%(DHĈ[]A\A]A^A_@HpHHȯAuL LDLHLLY9Ht$$HHH`0HCXAHt$$H7IHD$@I~HL$@D$HL$HD$XHD$ HD$PHD$(HD$HHD$0HD$pHD$8H|$1HIHLIHtLHt)Ml$MtA}tLHHD$I<$>I<$rAT$e0FpD$cH߉D$l L IH5 1DT$L 1H5 E1@L< 11 H5 WLL 1ɺ1H5b .E1afDHL,  IH5' 1L 1ɺH5 E1AME1WHCXH%r @AHsI1D$IFHGg jk]EFHOI~HGHǸGH9L- IFHHGH9LK1MH5 LcLLHHuL 1ɺH5ϸ 6DD$EHL; 1ɺIH5 1^cfD$L 1ɺ!H5a 1+DT$1D$L 1ɺ@D$L͌ 1ɺ,@HXYHHIٹL) H5߷ AfDfDD$LM 1ɺ03H^AFPL H5] .LD$ HL$(LHT$0I>LL$LD$8I>LHL$hHT$`LL$LL$L qH5 H<L% 1ɺBI%D$L[ 1ɺ?A:c IFHGJ AoD$]HL$PHT$HLI<$A6CA.YML$L mH5( ;ff.@AWAVIAUATUSHHH|$HHt$dH%(HD$x1HD$0HD$8q~I>HH]HHt$@jE1E1jH1ҿ jjxH HHDL$@EHD$1L|$8Lt$0LHD$(HD$HD$ MH$Kf.H|$0t0HT$8Ht&H@H@ H@HHtHL$LH9ЅHHHL$H$HMMHռLLHb IHuH|$L IH5 1^E1HD $D $HL$xdH3 %(DHĈ[]A\A]A^A_fLLUb AHtH|$(L' IvL 1ɺH5 E1nfD $Lu 1ɺ H5 1D $'f$LF 1ɺ"DL1 1ɺ1H5{ GE1zf.AVI@AUAATIH= USj HtM@HH HHt]L`A$H(Lp8Dh0H@DH[]A\A]A^DL 1ɺ>1H5˲ 1LY 1ɺA1H5 oH DH?t @WAVIAUE1ATUHSHF[tE1HAHۦuHCPHSH1H}H}IHtuH}1H'ZHHE1E1HAUH [4LHjAVH Å[]A\A]A^H萦Hq11L5 1ɺH5 M[]A\A]A^f1L 1ɺH5S []A\A]A^@1Lׅ 1ɺH5# []A\A]A^@AWMAVAUATUHHSHH(T$ HL$dhHH@L`(yHSHH}IHCPLHLO 1ɺHH}LHIXHHD$HM1AUL H5V "ILL$HAWt$(L\$8DD$,L7H ÅtEH([]A\A]A^A_L 1ɺH5 11Lq 1ɺ1H5 DAWAVIAUIATIHUHSHxdH%(HD$h1HD$HD$ xI<$ AEH IHI<$HHTWHHt$0jE1E1jH1ҿ jjIrH IH\$0A]u-LHL$hdH3 %(Hx[]A\A]A^A_HLT IH5 1aHL$1LHT$LL$ LD$sHD$H5H=> H€t:H1PL  1L H5 XZ$Ht$ I<$HT$(ÅII$HHD$(HpHxHCCfDLY 1ɺ1H5 of.L) 1ɺ1H5s ?f.L 1ɺ1H5C 1 SH[@L 1ɺ1H5  DATIHUHSHuC\UH= HtH= HI<$HHTHkjE1E1Hj11jjoH IHlHHÅL菾ÅuL[]A\ÐH="H€^H= H€?H=, H€ H=!H€IL "fDHL_ I11H5K []A\L 1ɺ1H5# f.1L 1ɺH5 []A\11Lu 1ɺ H5 []A\fDLI 1ɺ1H5 _jf.ATIUHHSHsC[H}HHnRHjE1E1Hj11jjfmH HHtzLHϷÅH]ÅH[]A\H1.L* %IH5 1w[]A\L9~ 1ɺ-1H5 1ML~ 1ɺ01H5[ 'df1L} 1ɺ*H53 []A\L} 1ɺ31H5  f.AWAVIAUIHATIUHSHxdH%(HD$h1HD$HD$ RqI}HHPHHt$0jE1E1jH1ҿ jjkH IH\$0A$u4LDHL$hdH3 %(WHx[]A\A]A^A_HpL TIH5 1HL$1LHT$LL$ LD$˯HD$H-H=e H@@@tHD$HHXZYgAVIAUIHATIUSHH`dH%(HD$X1HD$gA$HC[t1Ht'HCPE1E11ɺHH8HDI}HHFHqHt$ jE1E1jH1ҿ jjaH IHl$ A,$u+LsHL$XdH3 %(H`[]A\A]A^HL IH5' 11HL$HLL$LD$LHHt$H~H= ugH|$HtLH5 1Ń6H HL PLL$ 11H5 1IXZfHHL P+LL$(Lq 1ɺ1H5+ fH1vL %IH5 1of.Lyq 1ɺ1H5Ü 1EAWAVIAUMATIUH0SHxH?dH%(HD$h1AHD$ HD$( IHHdI<$HHWDHHL$0E1E11HL$Hο HjSjjE_H IH\$0A]u1LHT$hdH3%(Hx[]A\A]A^A_@HL< VIH5 1Y1HL$LHT$LL$(LD$ kHufHD$ HH=lH€MHL$HHT$(I<$Å&II$HfH1VL ZIH5՚ 1f.LYo 1ɺJ1H5 of.L)o 1ɺM1H5s ?f.HH`1PL a1L H5+ XZ7Ln 1ɺP1H5 1Ln 1ɺe1H5ә DAUfATIHUHSHHxdH%(HD$h1HBHD$ HD$(D$ bI<$HHyAHhHt$0jE1E1jH1ҿ jjn\H IH|$0Au0LHL$hdH3 %(DNHx[]A\A]fDH8L IH5 11HL$LHT$LL$(LD$ 蓠HHD$ HH=HAAEEH|$(1HT$ LEHH5 7NDL$ At A HD$mHAHeHEyO(E1ɺE1Lrl H5ŗ HHH5 PL 1L^ E1VY^oHE1Lq IH5L 11Lk 1ɺ1H5# E1L! 1ɺ1H5 f.H8HL PLL$81H5 zXZff.AT1USHH@HWHdH%(HD$81HGPHHHxHHjE1E1j1H¿jjkYH IH$H߅u1 !LHL$8dH3 %(H@[]A\yŅuD$ tHtaHyDLIj 1ɺ1H5 _DL!j 1ɺ1H5k 15^HuH|HHCXo!6fDAWAVAUATUSH8DD$dH%(H$(1HFH@PHD$D9{IIHH@AD$8L4H$H$yHrHIG@I<$1tiH=;H=n;L Z;1ɺP1L H5s  H=2;PLw 1KH59 ϭLN 1ɺ@LN 1ɺ$H5 虭@L 1-H5ّ of.L)N 1ɺ!H5 Aq@ã8=U;H  HǍHDHL 8;PHۑ PL H5G 1R9ڬDH Χ11%AWIAVMAUATIUHSHHHt$L$dH%(HD$8169L覞LI蛞HI萞H<$HD$肞LHD$uK|=ELl$HD$ ILl$Ll$x5F;H|$ H|$蛜IHHP@X$IuL|$0HT$0HT$AELIu LLIu(HLH$Iu0LtIu8LLeH;LH=6;$ ,@HHLM$PLD$Ht$ *ZYH\$8dH3%(HH[]A\A]A^A_D:; <;L=6H6HD$M/I9u fDIEML;l$IIw(HuIw LuL[ž; Ǿ;$bL-6H6HD$IUI9uAHIH;T$-HA}uIu(HHT$(lHT$(uIu LWHT$(uLL 1H56 ̩1LJ 1ɺH5 諩1l@$yL-6H6HD$M}I9uXfIML;|$EIIu(L萠uIu L耠uL]ff.fHHWPIHOHL 1HHH@PHfHHWPHOHL MȿHHH@PHff.@HL X QMHHHHDAWIAVIAUIATUHSHH_PHLLlH3H@u0HHMHMMRL,ZYH[]A\A]A^A_HL LRMLAXAYtHUPHHMH1ML HHH@P^_H[]A\A]A^A_ATUSct[]A\f.L+ H5 =X;tE;L%6 H6H+L9u EHŋCHLK8LC0HK(HS Hs{PXHZoHHEL9uպ;[]A\@LYG 1ɺH5֊ q]ff.;D=;Dn;Ðb; P; R;UH5 H SHHH?FH=rHuwH;H H5 qFL |IH5 1蚥 1LD H5t @H11[]hH;H= H5` EH=H HH5 H;u7EL6 IH5 1TfDEH;H H5 HzEHLJ UI1H5 螤XZAWE1AVIAUIH=ϛ ATIUHSHhdH%(HD$X1跚 HD$HDMHHǹ 1 L)c 蘝 H|$L^It$I $jH# AuML$L PH H SH= P1t$Ht$Ht$H%_H@ADžuA@HD$Ht2HH11t$(H= t$(t$(^H ADž}0t3HHu011t$(H=̌ t$(t$(^H ADžH|$0t$ t$ t$ 5];5O;5A;lQD|$`H0E Hl$HH5ߓ H H}nCH=_ HhAt$Ht$Ht$Ht$HRH Ht$(t$(t$(^H H耔HL$XdH3 %(DHh[]A\A]A^A_f.L1 1ɺ1H5 C fDH1H=^ 1t$(t$(t$(P]H ADž6M1L H5 誡$DH@11t$(H= t$(t$(\H ADžM1L H5C CfDH LA 11 H5 pf.M1L8 H5ى ٠S@D踔HL AWI1H5 E1蘠XZM1Lȉ H5i i@M1L H59 9off.@=;DH=m;@HXdH%(HD$H1V;tH?;1Ht:; 5&;t HL$HdH3 %(HXHM fHT$(H)D$0HHD$HHD$(HD$@D$Ht$Ht$Ht$Ht$HPQfoL$0HD$@DL$0H0) ;H;Ex ;tRL 1ɺD1H5 1L 1ɺEH5 J;D1L2 AH5 謞 ;ӕ;uÐH5ֲ;5Ȳ;5;W˲;H(fDATUSH~eLHM~HHVHHE I tbDUH RAQL /H5 ELҊ LD1ҝA[HXHH5 [L]A\&fD@tNuH$:H1RH5h =Lފ aXHZH5@ HL) 1DH5, ,[1]A\DH1RL 3H5 _HAXHLH5Q []A\KL 1H5 贜fL) 1$H5 茜[L1 1)H5\ \+L 1AH5, ,H1RH5 8LD YH^HH5 !AWAVAUATUSHxdH%(HD$h1HHwLHL I1HչVH5q vH=Ē LkEd$D$ H|$0HD$YI^H5 :UH1Lt$8H=O 1t$8t$8VH L ú0EMtBH1L1t$8H=d t$8t$87VH L? úH|$@t$0t$0t$05;5;5ծ;ID|$pH0ELd$XH5s HB I<$; H= HÀۅAE1E1E1t$Xt$Xt$Xt$X_JH HEt$8t$8t$8CVT$(\$,D|$0D|$H5H\LHH`tH*<L11L H5w (*#HLATL DLLJ 1H5+w uPLL€ 1H5v E HLATLB DLL 1۹ H5v LL 1۹H5kv 赅|ff.ATIUHSH2yt []A\fDHEHM $L pHH5u 1CXZ[]A\f.ATIUHSH>t21Lv 1ɺ H5u []A\DHEHM $L pHH5fu 1賄XZ[]A\f.ATIUHSH2t []A\fDHEHM $L pHH5t 1CXZ[]A\f.ATIUHS~1fDI$H;D.;DH;t.H=;tR1H=Nh our;H1Ls ?H5e []A\fDDHH[]A\fD;tӋ;H{Hg t&z;tl;tH{Hg [H]A\D1Lc H5Za p[1]A\ff.fSHHw/H HcH>@H[7[fDLNc 1[H5` #pAWfAVIAUIHATAUHSHdH%(H$1D$8)D$p)$)$)$00;L;#HH9 ATLto H5` HHD1ɺ)P1Ro_AXH}hL|$p@LÅHHH=e HE1ɄH=e H€Hd EHa u(LHDЀ|$pLL$ HLDHt$MHT$HL$LD `H|$PjHT$ H5` H a Lc1R1VLL$8H5a AQL _ VHt$8VH5a QH _ AWVH5_ ATQSVHL$pH5Ra QH _ ZHpHt$h|$PHL$8HT$<ÅD$<(D$8tALLm 1lH5h^ mft$ht$ht$ht$hH H$dH3 %(H[]A\A]A^A_@L1m 1$H5] DmfH\$@HLL$(HKH Eu(LH0` HHDL|$pHt$LDMHL$HT$ LDLD$e^H|$PjHT$(H /_ RH[^ QLL$@H _ AQL &^ QHt$@H _ VH5_ VH5:^ AWQATRHL$hHQH ^ VLD$pH5_ APLc1HpHsH-H`HLÅ1ҾL+HLcfD$<D$8L=,~nLL$H1iH5C\ L^ @H11ULL$tkY^D=*m~sL,l 1|H5[ 7kf=-uLLk 1ɺs1H5[ kMJA>fD=(HPL@^ 1H5j[ jXZDLAj 1 H5:[ jE1rL9 1ɺ,1H5[ Ojf.HyLj YA)HLMk )HLj L!j 1ɺo1H5eZ i`ATIHUHSH@dH%(HD$81* };};HH LL\ H5Y HHDH1ɺP1 iHZH|$ Y^jLc11SL iZ H oZ H5\ _AX1Ht$(|$HT$ D$ to=.t/xgHH=+_ t$(t$(t$(t$(H HL$8dH3 %(H@[]A\Ð=.tt|H1PL1L[ H5X hXZfDLi 1ɺH5X gH`HL#EfDL11LAi H5S bM1L%g H5S \bE1eO1L~V H5R @11(bA.XYAWAVAUATUSH(dH%(HD$1pv;IHH$H=p AAEEAA$HH=K €H= H€1L|$Lt$L-U \DDL$A1ҾL 9IL(U 11>H5Q `1TIM1ɺ'H5yQ 1`AWE1E1AV111jH=T jSjnH0AWHH=J tuH= H/Le 1ɺ4H5P 8`;DL$AuuILe 11LH5P `AHL$dH3 %(D H([]A\A]A^A_@uH,$HH=k tA.aAvA]H= HA-hD$ƒ8L@f 1ɺ1H5O ^fDH=m HA$AfDfHs R@Lc H5'O 1o^E1mDL$ LBc H5N 17^DL$ 3DDL$ 8L` D$tHH= ELbR AH5lN 1]E1LMc nA- A.Lc rA&Lc tA'LQ vhD$H=S H€Lb peL5Q  A&HFL LEL_c 11H5HM \L` 1cH5$M n\DL$Lb 1ɺ1H5L C\FLc 1ɺ1H5L \DL$(Lb 1ɺ1H5L [Lv` USfAWAVMAUIHATAUHSHH(E8dH%(HD$1AzAHH=_j HA7H= HuA M$A$$$H ^fDLQ1ɺF 1H5> gM2fHHt$0Mt$@H=B jt$@t$0t$(LL$8H0HAĺ AWLH5= LfB LY^LlB 1ɺ 1H5u= LH`cD$$/fDLt$H=Y LvZz_D H=A HZ H=w H? AW LN@ff.@AVIAUIATAUHSH~P ];];twHHEXHH`HuLMtaH4rZuhH`HuYHUHHuPHM HATML,XZ[]A\A]A^DH0[]A\A]A^Af.HEPHLT Q H5,9 L1gHAZA[[]A\A]A^H$H%zH&H'HBHcHXHVMtH= L HK HSHHsPHLA uy@HHEPHLT  LuHH5'8 11mGAXAY|@HHH4HHHHH@HHMt$H= Lu E[@HM HUHHuPHLAHHEPHLR LuHHEPH1H57 L<  1LuH1KF^_\HH%HEPHLR LuHHH{ 'ff.@AWAVAUATUSHH $HhMIHIAdH%(H$X1LMLH5?; 9LH59; HE1D$r9HAH{PrAtHDY;E@Y;t~}4|DLHLsAEu A$@upH$XdH3%(DHh[]A\A]A^A_L}Q 1 H5f5 DE1D$E1=Ll$H{ @D$LtHCPLt$PLKHI$@H7: LL1 KDT$_I|$LDT${I|$LHzDT$H@HCPDT$HH54 L1LO CY^DT$fDD$tAsH5= H=N9 0HD$HuCJfDHPH=.9 Ht:HH=9 t H|$3HuH|$0fH|$0a<:ff.AWL=9 AVAUILATUHHιSHdH%(H$1t0H$dH3%(|HĘ[]A\A]A^A_DV;tƋV;tHBHLt$@Hz Mĺ@LH$ÅHHHT$3H|$ jHT$H 3 L 3 Lc1RH57 1QH 3 AWQH 14 AVQH 44 t$8QH W3 SL$1HP|$ HT$L賳DL$ÅA!ASLN 11ۺ H52 1XAt$8t$8t$8t$8I,$H fDL1ɺ 1H51 Ajf.DAAE[I>1H56 z L6 HHt.I}HƻwHH[]A\A]A^tSEL$EHL11LL H5'/ v>aH) HH=4 HuLHnI@HuA$ucAT$uLL @L4 HLMA<$It$`H苾HbHpHL LÅ`HAt$`LLK H5. 1L=Y^5It$`HHHpHL LwÅHAt$`LL(3 L3 HֻLMHAt$XLLJ 3L#J HAt$XLL0J H5, 1H<_AX0HAt$`LL4J HAt$`LL2 f.AWAVIAUIATMUHSHHdH%(H$1PUx:aM( P;O; L|$@@LLÅMHHLHT$,H5h- H|$ jATL , Lc1VHT$ H5, H , RHI- VH5, AUVH5D- AWR1AVVH5*1 SH`Ht$8|$ HT$1ƬDL$Åt DEy$L0 1L H50+ z:t$8t$8t$8t$8H H$dH3 %(uqHĘ[]A\A]A^A_fLH 11ۺ H5*  :L1ɺ9 1H5* 9z1DAWAVAUATIHUHSHHdH%(HD$81vN;N;HH=0 ÀۅH`HL薴>LLL*H* H * H|$jLc1AWH5j/ L l* R1AVQH l* AUH0Ht$(1ɋ|$HT$ ͪDl$ t$(t$(t$(t$(H Ey2fDL$ LG 1 H5) g8JD1ɺHL.u* LLjG H5( !8HL$8dH3 %(HH[]A\A]A^A_fD1@11HLuq LLF H5b( 7Dt$(t$(t$(t$(H .ff.fUS1HHK;dH%(HD$81K;H(1H|$E1LcH ( H5- 1NHt$(|$1HT$ D$ Rt$(t$(t$(t$( H HL$8dH3 %(HHH[]fubL9- 1ɺ 1H5' H,- Z6LE H5& .6YfLE 11ۺ H5& 5%DE@L, 1ɺ 1H5u& Hw, 5L=, 1ɺ 1H5E& H0, 5,ff.HGXH$H&H'r{H(rt umHxhH4raH-rZH.rSH/rLSHuGHCXu>H7r7u0u)H"r"H!rH[Ð1D1[@AWAVAULATUSHHL9tVIIL5C fH{t2Hs1LLŅt@G;D$G;L-C KA$HLH;Lx$H5$ 1H $ H|$jL L$ LcS1VH5$ AVQH A$ AUH0Ht$(|$HL$HT$ 蟤DL$ bALB 11ۺmH5# R2ft$(t$(t$(t$(H Ht$8dH34%(H@[]A\A]A^DHP@HL-mLLA 1۹H5p" 1H`mH`HZUDL$ H5" 11Z1%DMLA 11QH5! '1fAt~ED$u;H@BH`$HHLDHH褫L1ɺ}1LPA H5]! 0A$L11L) hH5 ! o0'DAVAUATIHUHSH@dH%(HD$81RJD;AD;3HVcNHL3ÅLLH_!Hi! H|$jAVLc1H B! RH^! H5& AUL ! R1SҚH0Ht$(1ɋ|$HT$ 艡\$ t$(t$(t$(t$(DL$,H AEHH=% u?W H5 1Le@ /H`HLJf.HL$8dH3 %(H@[]A\A]A^L? 11ۺ, H5@ .t$(t$(t$(t$(DL$,H At\L? 11ۺR H5 6.VLL*? 12 H5 .%L11L' M H5 - %fUSHHHHdH%(HD$81HHIL ? 11 H5 b-H^$ H|$jH  SLc1RHƀ L  UH5($ QH  R1[H0Ht$(1ɋ|$HT$ ŅtLt$(t$(t$(t$(7H D$ x[HL$8dH3 %(HH[]fIٹ( 1L# H5? ,L1> 11. H5 Z,Iٹ1L)> / H5 3,Xi#fHer @H p @SHH0H[fDHGHWA E1Hp0HBPH8gfHGHWA AHp0HBPH8VgfDHGIHWHHxPHr0HH?eff.HH=}q ff.fHH= ff.fAWAVAUIATIUSLHHdH%(HD$81I@L$D$HP HJXHtHT$1LHC@ŅL|$ H{fHD$0L)D$ \HCHT$ HH9rH)HD$ H'H;D$( T$09r)ЉD$0(T$49r)ЉD$4LL1H{謾HsLHNPHVHHH>4Lw1ɺIHHHxdHLHrH辝IHHHLH@LD$LL$'HMAWLL$LHL}XZHL$8dH3 %(HH[]A\A]A^A_fDL> 11H5%; (Li1ɺH5: 11}(H@&H+D$(HD$(QL)1ɺlH5: A(L 1ɺ1H5:  ( L1ɺ1H5r: '-ff.fAUATUHSHH5D: HHdH%(HD$1]1H5: H$IHttHELHxPlIHHHT$H59 ,ÅL$A@L1H;(ÅHEHHX 3fDL 9 "LX= H5j9 11&HL$dH3 %(uH[]A\A]fDL E9 L= 1"H59 &MXL= fLI1ɺ`1H58 _&oDAUL-ATL% USHHHGH@PH(#HHB1L8 IH5o8 1%XHB1L|8 IH5=8 1%PLL b8 IEH1ɺ<LY8 H58 P1%QLL <8 IEL)8 1ɺ<H57 H$1K%RLL 8 IEL7 1ɺ<H57 H$1%XHZA1L7 IH5Z7 1$ H4H hA1L7 IH5!7 1$D$11L7 H56 |$<SMDH11L 7 L7 ATH56 C$(YH^4H @1L\7 IH56 1$,H4H @1L:7 IH5L6 1#D411L7 H56 #D811L7 H55 #D<11L6 H55 W#D@11L6 H55 /#DD11L6 H5}5 #DH11L6 H5U5 "DL1L6 H545 1"D011L6 H55 "TH1ɺ[I]A\Lk6 1A]H54 V"fDAUIATUHSLHILd$0HxHHHrH^HHsAHLHFPLNHHt$8LAŅtgHHxgHS1L狀XHRPHRHHHrAŅtNHA[D]A\A]f.1L'1ɺH53 ?!HD[]A\A]Ð1L1ɺH53 !HD[]A\A]Ð1L1ɺH5Z3 E1 HD[]A\A]ff.H1]ff.SHH>8 Wt [L7 1H52 R [ff.AUATIUHSH(dH%(HD$1.Åt.4;tGHt4;T4;!ЉE4;HL$dH3 %(zH([]A\A]fHL$ LL$LLD$H5e X4;2tD$ T$u T$H5B LHtH@ H@XHt 11LЅu21H5& L-3B1H5B L3)3;D$  3;eKH1ɺH2 L n6 PLH5#1 1AYAZf1ҾLHHX HL-2 fLcA<$u=H[Htl;tL 5 1ɺ1L( H50 /DLL u 2;H502 L u 2;fD2;2;҉2;t HG5 1ɺPH1 H5 0 PL A5 1L4 Y^62;<2;H1ɺHj1 L 4 PL$1H5/ 6D$A[[Å@H5Y' L1ÅDH5I' L1ÅHH5?' L1ۻÅLH53' L1躻ÅT1L1ɺ6H5z# []A\L1ɺA1H5J# kf.L1ɺ81H5# ;f.LY1ɺK1H5" o f.L)1ɺD1H5" ?f.L1ɺ?1H5" f.Lɰ1ɺE1H5Z" {f.L1ɺM1H5*" KLs1ɺQ1H5" %LM1ɺR1H5! cL'1ɺS1H5! =L1ɺT1H5! Lۯ1ɺU1H5l! L1ɺV1H5F! gL1ɺW1H5 ! A H5$ LH1ÅKLF1ɺ[1H5 \L 1ɺX1H5 6AVIAUIHATUSHHHHHH1T HLHC(H HCH5HC eAąHQ LHE(HHEH65HE }GHE0HtHMHLQeAąHu(LK(~1A1ɿL7# H5 $ XDZ!;[]A\A]A^@1bE1LR$ H5\  H[D]A\A]A^DH1L1ɺmH5  [D]A\A]A^1LW1ɺ|H5 o [D]A\A]A^HHpHHxHHAWIAVIAUIATUSHI}LxM|HHt7LAHuE&LH[ID]A\A]A^A_fDAAVHAUATUSHdH%(H$1IL tV_LJHtL-۲81Me)HHLHt>I(1t I$Hu1H$dH3 %(u#H[]A\A]A^@HcHDAD4@AVH@AUATUSHPdH%(HD$H1ILA:LHt,LoHtD5/;E~CL%t;1LDHD9t$H}LuHcHIDfD1HL$HdH3 %(u HP[]A\A]A^d@:HA w HstHƹ H=5 t2HcHHL8HHP HtOH5 1@tSt^uADA]tHPH5 19flfD\fDAWE1AVIAUAATAUHS1H-@I>D tVA t;0LHHEttLtgEt|fDE uAfE tH5 p 1gDHUH5 1IHUH51)b@E uH[]A\A]A^A_HH5 1[]A\A]A^A_f.1?-t -tHI1L ] NH5 1HAVIAUIATL%}8UIl$0SH t,HuLuHcHAD[]A\A]A^M1L\ H5 9[A1]A\A]A^f.AV@AUIATUSH`dH%(H$X1H$Hl$HaHt$ HH߹_|$ ~}E1L%!n I0fHTLHtHLHI H9\$ H$XdH3<%(LuH`[]A\A]A^DE1~ff.AW|AVAUATIUSH8H|$Ll$ HHt$LdH%(H$(1D$1A-@H53m LHt uAL$ H9l$~wM|LÅLHI $ u_LBHtH|$L@ID$H5l L\HtAL$ H9l$H$(dH3%(uGH8[]A\A]A^A_1MLZ H5 HD$H0HL< H ^HcH>1VfDH=M Hf1GfDH=~T HָtH= f1ff.fAVE1AUE1ATUH- SHHdH%(H$1ILHH/fD t \tIcAAtIHADH9H3HHt@Et\uAuMcLH5/ 1B4Wf.Eu AE1fMcLH5 1B41L繀HH-EuH$dH3%(uH[]A\A]A^ ff.AW AVAUATUSHXH|$Ld$ Ht$LdH%(HD$H1H5W LHD$HtE1kD9|8LD)H};DLcN|\HL$HT$E1LI6{AtjAfH|$LRfDEtbHDH  HELP PH5 1QR"AM0H HD$(dH3%(uH8[]A\A]A^A_H HAUIHATUHSHH(dH%(H$1HH.HHtVLd$Ht$ HLT$ LHLH$dH3%(ujH(H[]A\A]BfM0H$dH3%(uHHHD$HH'H$H|$H H$H$DŽ$E1H$D|$|L$L|$MIHL$0H$:fD$HH|$ LH`IFM9t?IH;EJ,AtH3HT$0A1LHqIFM9uD|$|H$L$H|$H)HD$(H.54|$@)447Ht$H|$ LE1D$fM1LR= H5J K0HD$ H$H8[HL$HAH)L"1ɺ8H5 :f.E1H$dH3 %(D H[]A\A]A^A_ÐL$EHD$T$HxH8 T$Hދ>H!ကtωT$DH~HD@HH)LdHD$ LH8T$HH= Lt$HHLLA H1MNSInXZD$DD$u E!H=1 LQj@K0DL$EE$H|$LD$D$hD$dD$lXHD|$|H$L$E<HH8 HEL; QH5 P1R_"HL$HH HBn;L0H)n;HB0H('@H5H9QtD$:E1H5 HHt HD$H0H5 HD$HFHD$H08ML; vH5 ;K0)fD$EHD$D5A  HL$AFHE1L$H$5Lҹ LT$8$E1ۅIcHL$LT$8L|$0HD$HEHDl$(LL4*f.AFAID9$`N,H=ۖLt¹H=9 LAFA@DT$EuFEtA$Ht$LH|$ hD$D$lD$dD$hH= L^zDL|$pLHAٹD$HQ L8 PH5 1ATLH uk;HiD$x5H L0|$E$1DŽ$HHH$HL$uDl$(IL|$0:$IHt$H|$ HEL9%HʼnHuH$LtIuR4AI0AD9~\IcVHIH)HTB HRu1H5l I>t LDHfDD4EHcЋL$H- 8HRHLd8pH5w 1eJH5T L)HDP HH1:I|$ub41D4AAI0BD9+Mc<$JML)| tȅrH5 1mf IT$DH1ɋ4f4Lk@E1H-86fHH5t ¿1hI}u_AI0D94EeASIcHH)HTB HRu1H5j  I}t 8LDH9HcD$HRHLd8hfDH5 1JH5uj L)HT1I|$uj4D41ABI0D9Mc,$J<ML)| uAtTtH5/ 1o@ FIT$DH1ɋ4D4wfH;L$L$D$ED$D$D$=:)H5 1 D4x:EoDd$E4H4t=H5W 16H4H4HH5H 1 D\$ED4E~L8 E1H-]8M4AI0D9Mc0JML)| tH:;4~/D;8 tHh HRHH H0D;htH9uH<$tH$ ~FElH5 1LD$$JH5 L)HDP HH1LD$Ix9H5Q 1LD$LD$H5( 1 T$uH{HtH( []A\A]A^A_DH5 1]4tH5 1E1=4H)!gAH0D94KH}t :H1HH;DD$D$PE1AI0D943Mc7JML)| uH$;4~1D;8 tHh HRHH H0D;htH9uH<$tH$ ~BmH5 1JH5e L)HT1IuH5P 1տ IWDHD LD$DHIPLD$D$D$4H`(E1fDAH0D94H}t jH1H H5, 1 64fDH5, 1վH-N8H;p+H5# 1訾D$fDAW1AVAUATUSHHt$H5 fH-;4H8 E1L%8I-H5 1%4AI0D9IcHIH)I Āy H $tH5Z 1ܽH $1H5 Q HI载Iz H|$IWDZfHH=[]A\A]A^A_fD~E1+H5 1MAH0D94~HcHIH)M,A} uH5 1 IU1H5b H{t %H|$HSDoff.@ sAW1AVAUATUSH(H-8;D4Lh D8 A@H@HLDEuHHuH([]A\A]A^A_E~%AA9tHh DH0D9HtH9uHt$I1H5 1H}8Lx M@HI8H>AAڅt܋4~098 tȃHh HRHL H09HtH9uA>t1DT$H5 tHD$DT$4~qHD$98 tzHh E1AA9tPH09HuAIN 1H5 DT$D\$Lc\$HD$DT$K[HH@ uH5W 1ܺE1뜿 HT$DT$H|$HT$DT$H@ DE1II8I%CDt܋4~8DD98 tƃHh HRHLH09ptH9uA?uH5 1HD$4~eHD$DD98 tlHh E1AD9tBH09puIW 1DL$H5_ 躹LcL$HD$KIHH@ uH5 1芹E1몿 HT$豹H|$HT$H@ HH(H=a[]A\A]A^A_̸ff.SHt1HH?H3 H= H=" y H=p# c H=B% M H=|& 7 ݸH=& ! ǸH=p' [鰸H=! 蚸`DH= ԷH= ȷ nfAUATUSHHH:HHItnHuHLAŅt H3HHL[1]A\A]rfDLh1ɺL1H5HD[]A\A]f11`HHx1ɺIE1L`hH5AfHA[D]A\A]ff.ATIUHSH?fHtyH@A|$ CtLCAD$AT$H C ЈC諌H][]A\DuCK[1]A\fAWI1AVAAUATUSHHhdH%(HD$X1yHH$HsH߅H%HDGfHHD$8HD$HHD$ HD$(H\$0t&HlLl<HwtHf HQsH߅A<4+H'tL$F0HxH߅yL- LL$FHLtH=H,HtL$FHLtH=MS H HL0H7wHL-1Ҿ HfHHL$HT$H1LD$H5+ }LAăxD$T$_H f D$fD$DoHD$BHy!HHxTHT$ HHo'HD$ HHD$80H=HtHYHD$@ HHHl$0HL$FHtL$F HptL$GHZtL$F@HDtL$GH.tL$GHtL$FHD$(Ht HHD$HD$@@ 7HsHHD$ HH$MDHAp.H|$8HD$ HtH9tH;t `HD$ HH9H`8LiqH5i1AHL$XdH3 %(DHh[]A\A]A^A_fwL*uHHL(|H5A`uGL-HLH=Hdd$FL-aP1Ҿ_HqHHsHD$HtHt$Hw\1Ҿ_HA-LIH51rwH蓿L$FBHsLE DH=&N HH€H=[H€HD$ HtH=& HLjs+H諾tfDH|$]H]Kf.I1LjH5{A賾fD1ҾsHH6 HHDfDHt$ H]H*PHǃP LaH5A%H|$ fDH=vL HHLH= HH= H7D$@Hl$0mLS^1ɺJ1H5+Ac@fDL!fL@1ɺ1H5A@H蓼fDL]1ɺNH5A˼fDLA1H5^蜼L1H5.AfCL1H5<Hl$0Ht$ HT$(D$@HL\1ɺH5AHl$0Ht$ HT$(D$@H`L\1ɺH5VA蓻pLw1H5,jH=&HH=" H H=XHD$@Hl$0Hl$0Ht$ HT$(D$@HzL[1ɺH5pA譺Hl$0Ht$ HT$(D$@ H)dLJ[1ɺH5A\9sHHl$0չD$@H=kHuD$@Hl$0H5WHFuD$@Hl$0)1LH5v蹹@HHfUHSHHH5 HP1H5R1ILc!)H{PY^ޒtH{P!nt H[]ÐHHI$PLD1H5̸XZ1H[]ÐH HbAU1AATIUHSH-E^t/Et*t u`H[]A\A]fDH zÅuA$ uH;@3u A$@uEui1DL蛷u1H=YtA̭t8At2At,L1H5HHõDH߉t2H$dH3 %(HĐ[]A\f.HXuHADHHPtAtAtHCX u@u@uiHHV1H羀H271L1H5+H(v@[HELHIHLH=H1>LIEfHhL UIH51豯H{PNS@u)u [11É[fD ÅuL.P1ɺp1H5DfAWAVAUATUSHdH%(H$1HG(44qIIE1$D$D$ D$#fDIF(A44D9IcLHTRHl)tH$DŽ$H$HH$HH$$H$ H9uI|$P;D l? |  ID$P1ҾD$H8cLi1IT$X @P9PL$$fDD$ fD711ALLD$<LL1ɺ!I5f.  |'1Ҿ'LD$HIT$XHH39HH3H3HEƒL$$ID$Xf  DD$%1ҾLŃvID$PH@H@@Yt EvEA߉1A AA9HD SL1ɺH51Eī_AXE;|$p*DAl$pL6H1PA1LnH5R}L$D$XZ@=?ID$PLD$H.GHHʪ=H赪ZED 9E@ L1H5LLD$4$@_G yzID$PLD$L85.LHZLL蠩D$$ HcID$PHHxoHD$HIo@IG@1HD$H9Dl$(AH\$8Lt$03HM1HH C%AHmH;l$wH]H1t1ҾHIHH躛HL$IIcHID$PIvHx HHsI^C|5:RLH輠bGD踪L\7IH5Ⱥ1@L$tZ$LI1ɺL1H5质H$dH3 %(H[]A\A]A^A_D|$ ED$D$ H1If.HcLHTRHDlD货H H$H$H'H$HH$HH$HG=H$H_DH$H H$H L$H$AH$DHA9uI|$P4 A AAA$q襨yLDIH51ަE1ҋ4$tTL$ tLLDT$OI 1M~L H5h@11荦D$ DT$DL IF(449L$$D$9v n I|$PEtAuoLD$D$`)IH@@IHT$`LHHD$Z D$`$E1DA$LD$LA…D$1ҾLE1LA(ALD9o($AD7fD$HD$XD$PAD$[L(IH@H@ 2ILl$G^eHL$LHT$HLHt$PLL$XLD$`/ IEt$L@ tI@^t  t)HD$9Lt AD$^VLJw Ht$`HT$XHL $AH|$XH,DT$BDT$fLD$T)D$`)D$p)$)$)$m'HT$THt$`LI D$TU$1҉t%A AHT$`Ixt.$A AHL$hIt.$A AHL$pIt.$A AHL$xIt1$A AH$I t0$A A$A@t0$A@ A$A$$΃@  LDD$>1H=7:nL-:1ɺH5EE1($AA  A$A@&$AA A$AL91ɺL91ɺhH5g藘E1LX91ɺRLE91ɺD$D}LIٲHLAUIsH51A[A]LH葲HLiISI}jL6 IH51賗I}:I1M L/H5S@11xE1E|$pD9LHEPH51L.Y^WHH~3 gH8DHL花H' L ѯ LDHLPL71ɺH5|謖E111LH5X胖1H5E1L$bL襕3t$L1ҾLէC<L谰HL*yI_SHt$TLt|$TGt$Lxf.LCHLMyICSwE1E11LHL$`LǩtD$`t D$t[LLӫ<IH510[E1E11LHL$`LctD|$`Et l$tBL聯LIIH51ʔLMLٺYIH5p1虔LL=IH5<1eE|$p1EDl$(H\$8Lt$0D|$$E@D$$L|$L|$IDHD$I/IH4DL9|$uDl$$IH\$Lt$(Ld$HD$H3HxPIHAmLE1uC@L$*1ɿH5AH[]AL)1ɿH5kAW1H AVIAUATUSHH8dH%(HD$(1*?HLd$e LHjHrAŅGAǃHLkc1L=5HHIHHH{PHL$ӜH AVHL$HL HDQELAWLDH51Po1HEH HPHCXuHH%H*HCX 1HH4@HEHH@PHx軻IHgHEHpMLthHHx1Hu%qH4RHHH|2HQM<6D$ILLD$;ELrfH5HaYEHCPHH8Lr'1ɺH5Z芆D1)HL^VDfHS#L辅u!H負H=sH1q LLL#;Ht$(LŅwHT$$Ht$0LMŅL+PHt$(LLPSLLcE1҅'H{PL9X^L$ 1LaHKHH|$1HKhH{PHT$Ht$H;LHt$(H_Ht$(LL73LgLH茿.HT$Ht$(1L`;H{P?;H{P~H|$({L1ɺ IH5M18aLH{L 1ɺ IH51aADL2 L$ H5ƿ`E1w$MOHLD H51`D$CAHD$(LTJ H5ILHH10`L$zg L_ IoH|$($zZ L9 IIH|$(1ezL^` IH5ž1_T$$H߉$,zLņIPT$H51RQ q_ZYL$yLm IL1ɺ| H57)_LKHLу1 H5^E11VHLJXLIwX(xH{P$L1ɺ LL$L H5^E1S$LR1ɺ $L<1ɺ L)1ɺ $L1ɺ XAUH8 IATUHSH(HNHdH%(H$1H\$HdL xKL$H}PHLܬHtHHT$ L1PÃtNLH511x]H$dH34%(|H([]A\A]ÐL$ HL1dLx1LHLHuL{1ۺH5\kTff.AWAVAUATIUSH(WTHt$HvPHHD$"jL[D$ YHct$ I|$H讐L71ɺgIHI\$@Ml$@1I9t]LsjL]t=1ҾjLiH#I|$HDuI,HEHAIcHL9uHD$I|$E1LT$ HpP)HHuL[HL$H|$Hډ¸H([]A\A]A^A_fDHGXHE1HHHD$HL1ɺ_H5B4[DL1ɺdH5 [H([]A\A]A^A_DLlnH5ܹZH([]A\A]A^A_f.Ly1ɺrH5ZH([]A\A]A^A_LF1ɺy1H5o\ZH([]A\A]A^A_L1ɺvAWAVAUATUHSHHdH%(HD$1HGXH~PHH$ HCPHHHL,$HRtH{HLIQtWH=kAč@=wAD$DL1H5q^Y)@ML9H5F3Y1L1ɺH5%YDHL$dH3 %(!H[]A\A]A^A_DHCPLH5ͷL1Xf.H{PDDHuLPo 1ɺIH5l1WXH{PL;IH7H!LHLrL+IH51Wf.L1ɺH5϶WLy1ɺH5WY@11M0L]H5wdW1H5d1L}1CWHVuLH=胡HHEXHu)Hx$H-HHtzf.AwWDHਸtHH.MtI]HnH L>SI1H51SXZH[]A\A]ÐHhnLgIH5Ʋ1SHLDHEX"ff.AWAVAUATIUSHHHnPdH%(H$1Hf1Ҿ\LXHD$ HHT$ HL=Ht$ HHHDH9HL{PLsXcAʼn |AUA H&-HtHXH*mHH5SILO~C 1nR^_1L31ɺH5^KRfDH$dH3 %(uH[]A\A]A^A_HHEY@>uHEXHHUlL}X IH51Q-fHCPyL|L1H5taQHkL|IfUJI%I-HL{ HKHALl$0LDHZ 1LWHsLICPt91ҾL@bAA;FTtHD$7DT$EVTLOu3HjHHD$jHT$H=}H1蚚w IH51GfD˭1Lv H5@11GLa1ɺ 1H5wGPfHHAWAVIHAUATIUSHHdH%(H$1H{PIDLHaLH}aH1ɺ\UI1LvH5ҥFXHZ|At AD$[HjŅ.HIt$HH?HL`Lk 1ɺIH5X1CFH{PtH{P8L1ɺ1H51EL3E)At"AD$[tDL Es1H51LuyELDADžLHziŅL)1ɺ1H5R?EH$dH3 %(THĘ[]A\A]A^A_@L1ɺZH51DH1LL8ŅL1ɺ1H5DiH(_LH_HH=3uH1َTHDHH5Y H߉$P*H$ HiPt.H$ H@ H@XHtH1HAąLrL|$0IMXHT$HLIG1LH4}AąILH莪HOAąqL[H1ɺ^IHVPLr1H5AX1ZH51cLr@H!@LD$DLLH?AHHZHLWHHA[LHZHe1IٺLqH5T@H11U6@_AX9MLLqH51A?H$(dH3 %(D@H8[]A\A]A^A_@LPZH1ɺ^IHPL>q1H5?Y^1H51aLim?H>fHH)D$)D$ HD$q>H߉D$$`>LD$(t$(t$(t$(t$(dH LprH5ԝA>EH$ L?( H5LH(1>1ɺ@E1L:H5l^>afL1ɺ91H5B/>2f.L1ɺT1H5=f.L1ɺQH5ߜA=fDLHXWLȝIL 1ɺn1H5w=fLWH=gH1跇A%=(LWH=gH1g07ZYd.@AVAUATUSHHdH%(H$1HHIHIHI1HIHL=H} jHH$H}LxmHCHto/HB,HCHtYH}LMmHHtEH}L9mHCHt0HCH$dH3 %(HHĐ[]A\A]A^ÐLk1DH55H}H1.j@Lj11ۺ2H5Ŕ5rDH71MSLj1۹H5z5XZ8Lj1<H5_L5 ,fATIUH SHhiHHHEPHUHI|$HHHCHHEXHu.S 1҈Cu,C҃ ЈCH[]A\fDHH`H@HPH L9j1DH5wd4fI|$H1hL11JH5C04eff.AVIAUAATIUSDŘuqtMMH.8HH .8LHDȸHD[D]LA\A]A^fML@H .8[]A\A]A^fH0USHHGXu H[]@HHHX(ME\ L Rs zSLiH5.PHL LD11 3XZE\uH諶HHx{MLhIH5ّ12HlH@MLhIH512H[]SHZ2HtH{H1 [L1ɺ[H5?12[f.IH=Wn L€t H=+3 Lff.IH=(U L€tH= Lff.UHHSH6tH[]fHKL2ELIH5411H[]fDAUIHATUSHHHnPKHIU=H@[HsHft*HLL/uH K1ɿLgIFH5i1Y0HHJH91IٺKLgH5(@11Ƀ0H[]A\A]M,1LfH5/1L1ɺH5Î/H[]A\A]ML f'H5{/fL91ɺIH5_Q/{@LLf12H50/GLS.vHfHdVHcIH=eH1"y1),E1H$dH3 %(DHĸ[]A\A]A^A_f.HLHD$HHD$1HT$lLH@ PXqELHD$0HD$INHH$ L,HD$ HH 182D$8L' INHH$H HD$(H11b1H : LL^1Ҿ\L/HH$HSH$IL H$L蔬HH L( HD$@HHt$HHt11 H5gT)D$%Iٹ L Lv7LD$8*HD$0HD$INHH$ L^ HD$ HHF 1/L rLU1 H5(E1^@IHD$HI|$Ht$L_IvHI|$HD$9_Aon Aov0HD$0)$)$LE1]AZf.IHD$Ht_I|$Ht$^IvHI|$HD$^AoN AoV0HD$0)$)$HD$0 fHD$0fHD$@HD$HL$LT$tLLL$PH$H$HH$MHD$`PHt$ LT$XAXZEL$PAHD$pEDD$lIuXARLH$PSH$PHL$0?H  DL$pHtD9 H1ɺ D$|L;bH5uP1d&AZHA[@LHD$P@LL$PH$ L*H1H<$H,D$8T H<HPHӆPH 1ɺ PLL$ 1L[aH5Մ%H 11L(_ H5%Hɯ HD$PL$H>HL] DD$8EHL<YLL)j IFHHT$(1LLHD$8 H|$8MH@ H@ HD1p{HD$(H Ht$(HE11ALNXjjjjjQjjjH|$`n"HD$`HPH* Ht$(HHt$FHt$(H|$AIHLy LYj IdžHǃT IH5 HM HD$(H5HHt$T$t$VT$$Hdžu HD$(HHXt$xH|$($ 'L" 1Ҿ'L4t HD$(HhX3H$tHT$ 1HL H|$H $LHT$o L L E 迈H5 LpQt$XLL$1Ƀ1"^A_HT$0HtYD$L > LLH$AVjLD$(HA_ZD$ LD$HT$0HLLD$:D$HT$@Ht\D$H$L Ӳ LWHLjLD$X3AXAYD$ LD$HHT$@HLLD$D$H$HD$vD$wD$! L$L<H5~1i!D$:HD$@HD$HHLt$`t$`ARH$PH$PSH$PHL$PR H@[$L1ɺ H51 D$L$& L0LHT$|LL$H$L$L$XL$x$LI1ɺh xH$H_D$p^:9 LXID$L1ɺd %H߉$:? L6 IzH1ɺ HLn PHLQ[PH5~1ARLL$ H LLn LT$PH4$1H=Ii1ɺ0 mL+1ɺ( H5QxCE1{1H( HLoH5 HCHD$(H5 HL1ɺr :IUXLR$Lp1ɺV $LZ1ɺg $LD1ɺo s$L.1ɺj ]MAR t$8LnSH53w%A[]D$MR t$HH5wLRSY^D$PHxPHx.Ht$(H& LCHt$(LπAÅH|$(D$2LR| IH5vv1aHD$LHHp9D$HD$LD$HD$HD$H1LR IH5u1E1RH5 HHD$(H5 HHD$HHx'1LXQ IH5u1rD$,H|$($0Lvu IH5Lu17D$ff.AUATUHSHHHG(@$'t7LQ1H5t1H[]A\A]@E1AHuPSTLDHEDHHuLK1ɿH5vth됐HCXH{E1HH詩IHuL11H53t EfDAE1KfAWAVAUIATUHHSHHmAHE(@%*(QHCXH0AE1ADHuJ lEHH߅!HKX@HsPUTLH H\HmHLHH[]A\A]A^A_aH舗HHxXAADL%b <Li1ɺC^AAE11LOH5_rLH[]A\A]A^A_EL1ɺ1H5rDL%a 7<EH LD7L1ɺH5q1DL% ;H-$HtHhH(-ATLNUI1H5qnXZH[]A\A]A^A_HEXH}E1HH虦IHHKX@HEDHH,¸LƲ1ɺ1H5pf[,LBNI1H5pH[]A\A]A^A_ùLDNH5|pn@H+L( IfH+LqIhL1ɺff.AW1AVAUATUHSHHHLnPdH%(HD$81HD$ HHT$ IHh^Ht$ L聒IHm1H| HH!AD$] I$HHu!L*H=3NH1iZH5Y1@H$HL$HHEH $ESI~Ht$HL$0DA觎HHHD$H$0H[HH1&L>H|$H{HtuL$1LHG[HHHHD$LH1.L=;H|$HLHHvHD$1H4$LH$H$H$XH$,HI1PL=<1H5(XXZHD$ HqH5b L#H$ HHt$ H|$SHHL$(HxLLMHH=;H1Bf.Hx bL0I1H5QH$dH3 %(H[]A\A]A^A_LY1ɺ H5Qq1L81ɺH5cQPL1ɺH55Q'H|$8HtfDLْ1ɺZH5P+HuHHhHU L01ɺIH5P1@La1ɺzH5PyH|$ gLRIqDL 1ɺH5/P![Lّ1ɺ DHD$E1L1ɺ}H5OLy1ɺrH5OL LG5I H5aO1QH|$8H&fDL1ɺ DLL$(LO]H5 O31Ҿ]HHT11L=  H5N1H5N1LP  HJH=r 9LHHLLIHKS1I麌L5H5:L@H11ATAZA[MfDHLpLhLa5H5K1fH-sHE(@H{P'zHLIH1ɺAUI1L6H5UKB^_H{PwL6OH&Ll$pIt$HH LebLuLfx 1ɺIH5J1H{PxH{P跠L'HHHQ1IمL3H5sJ@H11UUZYfDMuM~LcfHt$ HHT$)D$ )D$0)D$@)D$P)D$` 1H{PxH D$ AD$[D$ |$hy D$PHqD$ uHHS 1HHa1 tP1Ls1H5fI@11MH<'1HH1HHӴHh AL$  HM(AyuAHLbDHE(xHdFL3H5HPB 'HXMHLfL KILKH5$H@L1#fH3H1H5G1L.HH/HHkN1Iٺ;L@0H5ZG@11Al@L0SfIEQ1LH6;L1ɺH5FHhkIHHxG[ M$L@kHH@@[I$kH@[C[I$jLtfHHI$IjLEH1ɺAVI1L0H5EAXAYH#H1LŃ*I9H)HL1IٺL0H5E@11gAfL)1ɺH5OE<HLHҞÅ1LH;à LLI}HK1I麆L-H5D@H11AT]A\DLq1ɺH5D1\DLA1ɺ8H5gDT.L1ɺH57D$1LLHhu?LɅ1ɺH5CI$shHHxCL-1ɺIH5C1f. 1IIL-1H5bCTI$I$gHLH-1ɺIH5C1fDLL9)1ɺIH5B1HTLU)1ɺIH5B1L#Cf.LI1ɺhI1L?*H5ZB@11AD$ HHML1ɺ2H5BnH1H5ALj)@111@HSLIHLH=(H1-L1BiXZH[]A\A]f.AWAVIAUATUSHH(dH%(HD$1HGPL(bHHŰIvH= AAEEu%LmAFAFhMf HL6ADžHEIN HPHq@HH9tu AF2D$HVULHCADžzLsL$Iv AVdI8AF`HAN(AV,EN|EFpWHPAFtPkH ADž2HALHC1IٺL*H5<@11DH9MDA:1L+~1ɺ H5V<CAFHE@HAVlANhDyEu)AAHDL$E1DL$D9AEAFt A~hTIFD$8AF uAFt0IvH=s L8(eE~E2E>EHEE^H@HHEt}Lt IV:H=% HHH=ٙ HֹH=0 €[AQ}A~dMu uAN`Av,DHDT$WDT$HDT$RRtFDT$EufIAv,H\AvDA@^HA@L"PIF uH55p(1AXAY$IV@Av,DHMTAfDLaw1ɺ1H55wfHXL!IgLIF 1@HDT$DL$MDL$DT$_L%"1yH5441ɺE1LvH54 AF`&HAH;1IٺL!H5u4@11\L v1ɺ1H5I46Lu1ɺH5 4nLiIF \Lu1ɺH53(fAWf1AVAUATUHSHHhLfPdH%(H$X1)D$`)D$p)$)$)$D$,DHD$8HHT$8I$Ha,Ht$8L VHD$0H L5H9tH@^WH@@tH|$0~WxLH|$0J L IH521H$XdH3 %( Hh[]A\A]A^A_HL$0HUHLH,HLt$, Ht$`LHA$ELHHuD$,H5c H=K) D$HD$0LHD$HD$@IH4L$LLLD$?LD$Ht. LH=4uHT$@H54LLLt$@I |$;|$KM7LLIH5,,1H|$0nL/IGDHPHLhL]L 1ɺIH5+1L|$0Lam1ɺLNm1ɺ H5t+fL/m1ɺQHD$IHIHAVL1AWI1H5+ K_AXHHHHI9HkH= 'L IE1*H|$0&LIDLL$8L*H5D),Lj1ɺ^H5)iLlBH5(HH3(Lj1ɺDH5(fH|$0xL- IDHHM3Lj1ɺQH5D(6LLIH5(1Li1ɺ`H5'EH[WL I L{i1ɺ|H5'HM$Ly t$H5e'WXZ1H5P'Li1LH2 fLh1ɺH5&Lh1ɺH5&bAWAVIHAUATUSHHHLjdH%(HD$81LHHI興HH@XDEML|$E11ALHLID$H@ H@XHt1LLЅ3H{PTHjLHWH/$HEP1H HHxn.H.HH#H,1IمLH5z%@H11U\XZHI|$HIHHATL, IUp5fHHH}HL%UI~H5$1AXAYLf1ɺ1H5$HL$8dH3 %(HH[]A\A]A^A_@|$=t$(1Ht$ H t |$ HLIH5"$1 KLe1ɺH5#@Le1ɺg1H5#fH8HH-HLIUw1H~1HlrO*1L1 @1Ƀ1H56#(LH蝆H{PԝtH{PyYLd1ɺ1H5"fLH5"f)1L@1ɃGDE1E11LHLtL$uZQ)1LxH5C"@11*DLc1ɺH5"?HH(1IٺL%H5!@11HLwHHtI}v;AML`c1ɺ迹ff.@ATIUHHSHǁuCC\uHuLt []A\HHvu[]A\LHH[]A\>ff.AWAAVAUATIHUHSHH(DD$ LL$tEHIH߉D$MJ}hD$u CY9H{P0M`H IAHCPE1L狰AƅDH)HHCXĀfD9|$KL4oHWH߉D$DT$HCZ@DD$ HL$HHLLItHLvbMpDE+T$jHLPt$ jDEtH D$ TH DHHHhHZDT$ trHDT$ DT$ tHLDT$ *DT$ tCHDT$ (DT$ t-H{PDT$ 詙DT$ tH{PtDT$  HDT$ MLIH51薿LH51rDT$ EA@HLLIH5>1)E1H(D[]A\A]A^A_@L_1ɺH1H5E1f.T$|$ D)uMLHu@HL$HKD$ LX_1ɺH51mDT$ =HL1ɺ@IH5I14AfL製HCXĀtT$ 9T$tHLAfMpjAWEHLPt$ D$$PDEtH D$uL^^1ɺa1H5tDT$Df.LH5Q1Hu LՇÅHID$XHHH@HuH=y Àۅu#L脺EEhLLlCAID$PLMtH=O LDuEu D]EElDuh3ADuhA)E(A9t0ML$HL11DT$H5. DT$AD$Yt }dHE AECuutm1҅HLDT$4A:1L$IH51覹L)DT$LAD$YE9v A9A9 E9LEDHLLUÅSM\LH 1IٺL@H511@M|Hu>oH= L CH511菸(DLOY1ɺH5z1eH[]A\A]A^A_@H&L vl HMLDH1H7 L- PH51XZfD}EEd]hAzDjL 1H5覷L LYX1ɺ1H5of.E9AD$YI$DT$1DT$LL "IH51L1fL: IH51诶Ef.+H1IٺL @H5y11dADuh@D)AƉEh@AL 1H5LV1ɺ1H51yfD1ҾLiL1H5蝵3U`LDT$ T$,9T$DT$ ;'L 1H5VC8fDD9EhHAt$HA1L H5AXAYLU1ɺ1H5Ǵ]fLDT$c8ID$Pu`H8=L 1ɺIH51yDT$gLH5TF;AVL5 AUATIUHSH9IEHC LuKuIE@t'HC H@ H@XHt1HLЅ0HsLDu0LKL脁u LȁuSu C tsfDLHs HKtHSpLLK|LCx?LKLu L_tzL讲uCpHEXH0rx@H6HHhH61HLH I+iHs>LoHC HKHsH86HHhHEX@qH1wH <IE@uHp(H=/p 1ҾLlIHC8tH= H€HƹLL^MGLLL&HC H@u HH[]A\A]A^f.H4HpHs LR1ɺH5'[]A\A]A^LQ1ɺH5[]A\A]A^þL^M7/H= L!f.HC L LH(1H5wd[]A\A]A^LQ1ɺH5E71LH5 HHLQ~LouܾuL^u˾HLMuL<uHsH=m tHC @HLVIHLIHLIL蟮uL芮yHC H@hĀ_HCH=/ H€ 0_AX諲I1M(L H5 @11D$EOD$Dd$ D$E)Dt$fD3I1ML H5 @11q|@H$rH=_ H5+ Nff.AWfAVAUATIUSH8dH%(HD$(1Ll$)D$HD$ MuLx1LHD$HL|$MovHIT$X1A$H[E1LPAjAWH ߉3D$tbH\$L9tXfL賍L{Au#@MDLLB H 7 :H9IELH9uHt$L]HL$(dH3 %(uED$L)EuzIl$HI%AU1ɺUILA H5 1ntZYD$t  DHT$dH3%(H[]A\A]@蛏HIl$I諎HAU1H5 UIL @Ǻ11s^_sH`L 麚I1H5Y s1RDH(L IfHL Ijff.fSHdH%(HD$1HD$t(HHt$HEtiH3T$9uHL$dH3 %(ucH[fHhL IH5` 1r1DLq1ɺH51 r1iATUSHdH%(H$1HH@V,HH' HH5 L4 S4HEttIƒuL H LCXH=ފ H HEL H MIVARLP1RH xH <$u>H@@u1H$dH3 %(H[]A\f1ҾHHtDH@@Hh($1L IH5A @11pHC\DIIH f.1L }H5 p1D1ML H5 yp1gff.fHtkATUHSL'HMt LguH][]A\HM+1SL H5= oX1Z[]A\f.AWL=> AVAAUE1ATLUHLSHHHHT$LD$dH%(HD$81VHǃnHnHHCDLHf,HHH@H @OjAA1hHhH51 hhj^j]j[hhhhhhjUjNhhjKjDj2j.hj#j"hhhj jhhZqHADž0[CH@HAH1jA hH5 hjhhhhhhjFhhhhhhhjUjNhhjKjDj2j.hj#j"hh~pHADžHltO{$jAA1hHhH5 hnH 4s$AH@AHH1H5> nL 1ɺ H@HA H1jAhH58 hhhhhjbjcjahhjGj=jFhhjShhhhhhjUjNhhjKjDj2j.hj#j"hhnH01L )HH@ D;ExH)ĄdH;"HD;H@EuHHT u D{E z HH@ H@XHH1HAHEH@ tL tJ@tLt) tL} H5 1E1jjAHhA1hH5 hhhhhhj^j]j[jFhhhhhhhjUjNhhjKjDj2j.hj#j"hhhj jhhlH01L pH5 1E1iHL$8dH3 %(DHH[]A\A]A^A_@1ҾHYnIH C$HƹH=8' E1AŅH LDH1H5B jL 1ɺ7H@jA HhA1hH5G hhhhjFhhjSjHhhhhhhhjUjNhhjKjDj2j.hj#j"hh+kH1LfH@[jAGHjb=A1jcH5 jaiH 1ɺLHAH1jAhH5 hQiH 1ɺL?#fL)1ɺDHuHCf1Ҿ9H?+ CC 1ҾL{HHkHSPLHHCPk+ 1ҾHkHHC`HS`LHؾHHPH EVH{`UH{HLC`HL{PH@H?Mt3LLHL$ LD$]LD$HL$ L{`HCPH{H`HA=H1jAhH5 hhhhjG`xH@d jAA1hHhH5 hHDL$ cDL$H1HAƒ tSpD9D;$SHbCtHHHP1ҾHtC|IHHPƀYEt {ptru HD$H8t]H tPCx(PH~L 1ɺIH5x 15b1ҾHp HǃshLm@HE@L9tkH\$ D|$IfI]H?ct2H1Ҿ,oHHH}HLa4%MmM9uH\$ H@-HD$HL$ADp HHDML^ 1E1WH5Z awf1ɺTE1LH5* `GfjAA 1hHhH5 hhhj'hjj$hhhhj^j]j[jFhhhhhhhjUjNhhjKjDj2j.hj#j"hhcH0ADžH_uH_( [Hv_CHZ_KGS$` L 1DH5 _H5 HHHH@H^H^tsE1L=ӭ L1ɺ]DH^mC fDLa 1H5 ^%HJ^xfH3^E1L=K@LQ1ɺ)D'H]HL H5s LH(1,^1HH5R _+ HH@yDL1ɺ1H5 ] fLXH)EHD$1HH0x/HHD$0HD$@SHT$H4 L3 1H5 >]fDL1ɺmDHA H1jAhH53 hjj$hhhhj^j]j[hhhhhhjUjNhhjKjDj2j.hj#j"hht_H1LDAǺTHCH@AH1SH5 ]ADž1ҾHejYL 1H5 [2@HS[H>[L H5 [H1H5z -]L&1ɺf1A$HAH5" \HH@IjAA 1hHhH5 hhhjjhhhhhjFhhhhhhhjUjNhhjKjDj2j.hj#j"hhC]HADžHYuHY[HYL 1oH5# Y;DLq 1H5 Y Lq1ɺ=H5ž YL@C s@HH@f.L1ɺ1H5p /Yf.L1ɺUDE H{HLC`E1HL{PMM}fHCX;HH@La1ɺ1H5 wX:fWgDHEXFN1L H5` $XML{PMLLNOML H5 W@HKWH6WE1L= NLQ1ɺCH5 iW,@L)1ɺjLH(L@ 1H5f %W~1ҾH\HM1ҾH[9Lm 1.H5 V)jAA^1h][Hj'H5P j$hhhhUXH@LB1ɺ:1H5 XVL 1VH5p /VHD$1HH0p/HHD$0HD$KHT$HaHSXLHSXHHS`LKXHXLHLL$ HT$MHT$LL$  HCXHD$AH{HLC`MHHTHHQL1ɺ^1H5e $U}LKHLG H5: THD$1HH0bo/HHD$0HD$JHgHT$0LH@HS`LD$0Ht'HLHT$ LD$KLD$HT$ < H{HLC`HHD$AHQ_L @H5f *TL 1H5B T1H fHL$HHAL1ɺ1H5 S E HD$HSXLHHHCX踫aH{HHHD$ALC`HQjjAA1hHhH5 hhhTH0^L1ɺx1H5) RA1HsLHnH{H8L 1~H5ط RZHL'LH1ɺ]H5 `R#DHT$EHLxLC`HLL1ɺH58 QH<EAxAQ1HrHCHHcHHQL@ 1H5Զ QVD;KpbL- ARq(H5 1]Q_AXLI(APAWL H5l 1)QAYAZLѼ 1UH5= PL1ɺ1H5 PHTPH?PE1L= WLq 1H5 tP7LK`C1ҾHaHDL$PHAZ 1L H5= PL1ɺbH5 O1ɺFE1LH5 OH4OtHT$0FHFC|L H5 ]O  Hǃ`>L1ɺH5N OKp <cp@t {tH\NHtHPt 0H@ :C|L[1ɺ1H5 qN4HMHHD$\Ct L$蜫1L| IH5K 1NHHP3L1ɺzH5 Mx?DL$蹳L2 H5ݲ 11MHDL$HA-Ly PRg.L31ɺH5 KM1LPv H5` $M}L1ɺH5< MHiL 1ɺIH5 1LHǃHL1ɺH5ܱ LcC1HmLH!H{H1Lx H5 LL1LQ H5a %LD1LĻ Sq(AL߻ ASq(u1Lǽ H5 K1HlLHIH{H_HL H5 LH(1iK,IL E1H5 >KHLH(RAPLt HHLH(F1Ls 1ɺ3H5 JCpH1Lc H5ѯ D|$J1L H5 iJ1L H5~ BJ1ҾaHXǃPbHIcHI1ҾcHNH`H脨ADž_L1ɺ1H5 IH&IHIHH*1ҾHE12I LH(11L 1ɺH5Y ICpHLH(B1L( H5 HL1ɺ1H5 HLH()1Ls H5˭ HLQ1ɺH5 iH,1ҾGHY1Ҿ=H艃Y艃;tCt9C|bHds|HHD$(dHD$ HLH(LL$HL$(H5 L QHT$(11RLL$(]GCtC|Y^Lq1ɺH5Ŭ GLLI(L 1H5 ^G!1L H5s 7GL11H5W GLH(u}1Lk 1ɺ;H5 FCpH1ҾHXXu]E1L=j d/1L H5 F71L H5 \FxHWH1E1Ɣ I1ҾbHsTl1L H5" ELH(J1LD H5 EV1L@_ H5Ъ Eff.@AUIATIUHSHZHHxHPHu(HU`Ht ]H[]A\A]fHu`Ht* nMtHu`LHHH@HH)uMtLSDtLз +fH][1jA$A^H5P FFAYAZHHxHPH]Hu`!HthMLHHHR tv@] upH^L DIH5 1C@]L. 17H5 Cm@[@\ QH ^L IIH5 1VC"HLH(1RL H5_ #C_AXH[]A\A]H}Lֵ "H5$ 11Bf.L1ɺ1H5 B{f.HȵÅLW1ɺ1H5 mB9H}!KHE`HEPHA$11LM`H5W L  BY^HLM`A$?L H5 AXZf.AWAVAUATUHSHHHdH%(HD$81HAL(L`HXH$=1ҾHA S'HAE4@IBAXHRA@wA 1AHEIMIUHHpkHf@.HQ@tAM, H;@3E]EIHH H)s!AEHI9t$hLHH LHI4$H It$H$AT$ WEL$HIArH׽ JcH>fIuXHHHrEEI<$Iu`HjHbHH@\ LH 1H5| ;?H}H5& [IHZAEfDEA9LHAE1AVL#W 1H5 >A^A_f1ҾHc@AM,1ҾHLAM,f. HLE]AE0E|@L1ɺ H5U >L11H59 =H<$uHXHt1H H\$8dH3%(/HH[]A\A]A^A_1Ҿ'H9OASDIu`HCHLu_IH@] IL<LaSTL<tII3GX%H1jAALH5W >ZYLIAE4HLLIEPIEIE`IHHfDE|$ E2 Lu HLHD$;H9D$Q I1HJ  AEp1AAEpmL 1H5 ;* Du EEEAu!jH} hAA1H5 2=ZYAD$ IHHIEPIE`EMEuA}Lw 1H5# :fL1ɺ1H5 :f.AA@Li1ɺH5 :@1Ҿ;L) H9D$ IHJ+E}pfHtA@L H5" 9H}wVL [IH5 19Ly1ɺ1H5О 9f.EeH\R L ` L± -EH5 LD1C9L 1ɺ1H5` 9"f.A1҉ƉD$薳AE1I@A|$ADžE AttA9D1AIAUpL$Hp(T$Ht$RHt$EL VT$H5 RL$,jQ1AW|$8WP178EH0AMIEXHAAuxMLAA;s{H}HfTH}IAHITHD$蟝1Lα H5 @H11AWLL$m7EA_XAUt9r1Et$EyAUpE1DAօD)֍19{t$1ELO @H11t$VH5 6E]E)AYAZE3AD$ftEE< IH@H)Ee4EtI@HHtH=, I@tqAMHN L@(Hօt IUXH5 IE`MMPH I}HHHDMLDH1APL. RVH5 WP15H0HtHC(xB AMDLHLH¸HL<1ɺ1H5 R5UDA1҉ƉD$ίDAE9(DH}HQEIDL$1L H5 @H11AWDL$4A_EXE1E]EcIuXHVH~IH4AuxHFAAAƉD$AD+|$XIE1@EI c2D9+ET$H}EF AHT$D$H }PHT$H}IHbPH1AWI1H5 L S3^_D\$EfAUIHIHAutuo@u IExHuXEEPIE@PIH}jP LH u{L1ɺH5! 2HIEDQI}ElEeAuptBt<A9v)Aupf rLĦ 1H5 //fAE@#HHݼiL H5 s/vfDLi 1UH5 D/AM IHA>IE`IUHL  H57 ILݪ Hq(LE11R.^_zDHt$H}ZKL IH5֓ 1.L\1ɺ1H5 r.uDL 1BH5 D.H9T$_IHJ @\FIHBLJ 1H5 -DL1ɺ1H5 -fI@RL) 1H5 d-B9Hr(DHLS H5a 1-AZA[DDEt$ EtHfL1ɺ/H5 ,L1ɺ1H5 ,La1ɺH5 y,4@L91ɺ1H5 O,jf.Lɤ 17H5] ,HAIAEIEXHH^kFL )IH5 1+H}IA&LS1ɺH5 k+&fDL 1H5} <+WHMMXL۞ wH5< +AYAZ/LI 1[H5 *HhHH@HIE`E@MM`e1IEXL H5 p*I@fL1 1H5m ,*L1ɺ1H5@ )f.L 1 H5 )ADHAFAH}IH *FH}IIFAVL& ATIMH5 1I)AXAYL 1ɺH5] !)@L1ɺ>1H58 (1fHxCLt IH5 1(@L 1H5Ս (pLP 1H5 k(HBL IH5z 17(jHHIHeAux#LLyLBLӝ XIH5 1' LL2L@BLd SIH5̌ 1'L5 1H5 `'L\ 1qH5x 7'L1ɺ!H5O 'ML1ɺH5+ &L 14H5 &L1ɺH5ދ &LL"4LA1L GIH5 1^&IHHMMX31L' H5g &&HMM`H5C L %^_"Lr@L MIH5 1%MMXL 1wH5ъ %KfDAUATIUHSHHHAL(thIuPLLԡ \IH5l 1)$AUATIUHSHHHAL(=thIuPLܥIHt,HHH-ÃtWH[]A\A]DMMP1LQ H5ш #H[]A\A]fDH5 1L6 T#LH9tM1ɺLHsuL=L< IH5C 1#1L=Lt IH5 1"AU7fIATUSHHdH%(H$1H|$@Ld$)D$Hl$@M)D$ HD$0HHHLl$Pq1HH1HH,$Ld$Q|HHHHHAHEH:E11P1UjH$"H$H AHtHDŽ$HHB~H$dH3 %(DH[]A\A]f.LI1ɺ*H5 A[!fL1ɺ/H5m A+!tfDD71LB} H5: A A.ff.AU7fIATUSHHdH%(H$1H|$@Hl$)D$Ld$@I)D$ HD$0HLHLl$PƄ$艰1HHl$L$$~zHHHHHAHEHE11P1UjH$OH$H AHtƾHDŽ$HHo|H$dH3 %(DufH[]A\A]L1ɺyH5Մ A벐D麁1L{ H5 Ahff.AU7fIATUSHHdH%(H$1H|$@Hl$)D$Ld$@I)D$ HD$0HLHLl$PƄ$1HHl$L$$xHHHHHAHEHwE11P1UjH$}H$H AHt6HDŽ$HHzH$dH3 %(DufH[]A\A]L1ɺH5E A벐D1L"z H5 Af.@UHSHH6u HjtHtHBH[]Ð1HHCHtH \H[]ff.ATIUSHtZHuH,L '1H5$ []A\fDH; H&MHHqHusHubHuQHtHu`HHDE11PE1LjHj*H L9 4f.LH[]A\L( 9fgHHH2H8ff.AUATIUHSHH_G,<+<-G( HHDPuH1[]A\A] LHII9$tAUuH=vtEH9vfHEH9vSHHE HUH[]A\A]G(HMG(H5EEHDH|~zt:~Ht0t#Ef.f.t踢tہt~1Htc~Agttt`uڹH=5: H%@=wGEÐf.H=ff.AWyAVAUAATE1USHH4dH%(H$1H|$ H|$HHcHD$Hi H,DEnE96DH ߛ9HD)F4"IcL udAF0u\tt$ tPAFENAvM1ɺPH5 1_H=I9ZYLDADžA?AD$PI|$HJ<L rF9Hp LT$HL9Hc>HIH)I,E uA9uELM|$8E$IMǨteHtBtttE(9CsBI|$-LD$MHLD$HHE(H|$HLD$CTLD$AN|At E$AHcu t:H6W3HHH 6IGHLLHP`AAxHL׎ E1AWH5 _E1AXH$ dH3%(DHĨ []A\A]A^A_ÐHIV3AA)H7V3HcHIEf.E1Lܓ H5 VE1qL1 H5 ,E1GHUE HH N L ̍ HL RH5 QP1H E1$LMH HU3L H5U 01XZD$L 1H5" _E1zH 7' IFuH ' HI+H ' HT@SHs,sxnn[ fDATAULΌ S1HdH%(H$1HH1H1py4HuB9H$dH3 %(H[]A\fDH5Ht=Ha HHIAu9H$:u0H=w(AEHL$dH3 %(u=H[]A\A]A^DML 11x H5 OAWAVAAUATUHSH8dH%(HD$(1RH]E,IHHg LD<+<-E(D+PLo AEը FIHDPuA.t E:,$#Ll$ HLIHT$ :.E'H90ED:EfA*Yf/  f/v, Ef/vH, M EHf/vH,U HEHf/vf/H,HE A fDA<$.)H5D$Ht)ALHH5G D$HT$ D$E'H9fEH HD PH5ʃ 1QL E1iY^S@E(HE(HL UH5a 1E1HL$(dH3 %(DH8[]A\A]A^A_DXA?HT$ H . /@MAJH HD$@AD,Dw+t$D$H|$t$H HD$8A9t5HHuL ٺz1H5u DAaAtxAF LEtYuX.L 1H5 D\H,H?pD p f/s"L,L%u'Y[ fDf(\L,I?I)HIL͈ PH5i 1XZ H } tH1L H5E d1Lƈ H5! @HfDH1L H5 1Lf H5 HfDH&1L H5 1L 'H5a HfDH/1L H5% D1L 0H5  HfDH81L H5ŀ 1Lֈ 9H5 HfDHW81HtHcHvHf1HtHcHvHfDHHfDAWAVLcAUDATMUHSHcHJL)L,H<59DHBD($L}@H@L9taO4vL,[III_DH1t6J3J+ HJHHJHJHHJHHHJ R(HH P(M?I9uH[]A\A]A^A_HU8KvH HcH@H YfDHHW49HHL\ H)عNL*t# 1H5} X1ZhfkTHM8KvH[HHHHʋ HHHJHJHJHHHJHH @(HJ B(fDHHfDHcH39HH)HH@ff.ATUHSHHPHT$0HL$8LD$@LL$HdH%(HD$1HD$p$HD$HD$ HD$*DHT$D"$At.DHGuC$/vHT$D"HBHD$Au1HL$dH3 %(uaHP[]A\fHtCDHL8UI1H5{ 7XZfD\ff.ATIUHS1HPHT$0HL$8LD$@LL$HdH%(HD$1=fD%t#-ttHAuJDZt~t tсtɉHtHD$p$1HD$HD$ HL$pHD$H#оHt9/vHHu@t$MHL{ ATI1H5z XZH|$dH3<%(umHP[]A\@_fD뜐@$1sHG8HtHcHvHHDfATIUHSHcމtH[HID$8HhH[]A\ff.SHRt ǃH7H"H uA2Hu[fDHH= 2HHeH@IF(XIcĹKH5`9Hi5Lb LLH5V 1HHu 9s 9@La 1>H5U  18ff.tHcHH3f1ff.ftHcHH3f1ff.fH5_91HNDH5t99uHcHi5H@1ff.fHH@ L L!W H5T HLE11HS1H5T L zLV K H`dH%(HD$X1HPHqu]PHu|11ɺP L W` LV H5"T dHT$XdH3%(uhH`[fIL[V 11M H5S zIL?V 11O H5S ["fAVAUATUSIՃtRH1AA ID11H?EDH9[D]A\A]A^DHH= H€uH;3H8H Ht&@Hà ҾH`Hu1A LZU 1 H5R Lec 1 H5{R 1L H5WR  9~R1L%T H MH9H5R HHà pL1B;-9XZ|A[]DA\A]A^fDAWAVIH=T AUATUSHht$|HT$pdH%(H$X1@H1p7 =HD$pH8~I~H IFH H61ҾmL辖14I~Dd$|Hl$pA@HA9HD58-ux-uP HAH D-t#H9tHHt=uE1EtHuH9tDd$|Hl$pHA9vfDI~EAD$1L=-IH$fHCH9$HLl L-HI~L/LlL^I~LHI~LA9uI~H5 XLq1ɺ H5wO HLI~LHYuDLYq1ɺ 1H52O oLQ 1 H5O KI~IFLq1ɺ/ H5N 1@H$XdH3 %(+Hh[]A\A]A^A_DI~H5f i!I~ZIFHsI~TIF HHT$pHt$|LUAo(LAo8AoHAoXAohAAoxAoAAAAAA.L11L LP B H5M MN1ɺC 1LyP H5gM I^HD$pf/)$HHD$)$zHHPHW9HDE1H'HHT$ IHuLAH5H9uᾂLDd$H\$/T$A$4fDAf.A4A4~AE;oH zR9Ht$H@LHL1hHHH0D9hH9uE4EM 1fI0A;4E9,$uID$1A4~D$I*E1AH0E;4D9+uHC2bVA~fDIVH= HN H=|HDDAtDAHDADA=uDAGeDAUDA|EDAg5DA%DADADAfDDLH2 6H{ H芾fDD$HDd$xMt9D$&DT$@ED$8Dd$\fo$fo$D$XD$@)$D$`D$D)$D$dD$D$H,@DLH I|$ HٽI0A;4DA4~z$ID$1DLH$HH9$.XfHC1DLHD$0jHH9D$0MvD$EaD$@|$8QHcD$8D@D$88f.z!MU1ۉl$0$ALD$D$.D$D$}DA4AH0A9}DDL5u$AA4l$0\$D@HuHH=' >HB1ҾHHt/H脺H1ҾHHt/HZH1ҾHbHt/H0H1ҾH8H/HH@IcHi5H 34IF(1H-E xfDIF(94~cHcLHRHLcX+DSt1EI1ɺQ H5bB KdHIF8IF(94D$|LAFTHD$pIFXt'LH4 8LH=LuAL ;L9nAhIF @@BdLVLAo(Ao8AoHAoXAohAoxAoA AIF(PAAwAAA AAAA A%LxrL#%LAO)ALALAdLAtAdžIdžIF @ tA tAA#L 1A?5LA 1ALA AIF PЉA? #AA@ AA}LtANLȿtA1ҾLyHt"HƹH= uA?1ҾMf@LA?yLHHHHDM HھLLH% H=e HLQ 1ɺ 1A@H5 > F)LɾrLA A蜾LA AoLA 1A1҅ AL 1AexH H= H€t"HXHH€I#L軽tO1Ҿ#LHH8GHK0I>HIHEML6"LLtIHt 8I^@AI9JL=-LH Ht HL7HL9Hk"HþtH1Ҿ"HHtHǾ,I~HuHL׏uLR 17 H5; ߼L]1ɺ 1H5z; 貼LŊLqLaLXL&[HH5[L[LZILHǀI d MNL> 11 H5: LAo(Ao8AoHAoXAohAAoxAoAAAAAA\L44I~K豬\G$7L$Lt$Dȃ!9L$TD$9ND$TD$PAOĉD$PA`}DA4Y1I A uCIcHHi5H@HHH}3D HX H9H0zЂtfDD$DDd$PD$LD$D$TfDA RL軹t AdžL蟹t:H LI1ɺHIH# LTtAUL;t AdžL:L LvL\LҸBgL踸(|L螸L脸GLj=LPL6IFH= H€|HƹH=lLA H$LÅ $MN1ɺ L7: H56 1ܷg1L-: AH5x6 1賷 IL L: HH5C6 LE11}1H5-6 1L9 \L߶ <Lʶ L赶 L蠶ZAtIF @i -LsPLA AJIN LA ЉAA@E1A vŃ    1ۃ }LȵAdLA фADD薵EA IF @@ 1Ҿ&Lz'LA 1AoIH HOHƹH" HC MHǹL AH1ɺ PLI 1H53 !Y1^L%pH() IF @@. IF(HH HT$pLt$|H QAL胜IF @@1ҾLxLCL9 AIF @@L{LU1ɺu H52 *DL裳H= H~ H=HzA|f1H5>5 H=45 fDH L|HD$(tL%RLHRIH Hǂ!LLT1ɺ H51 LS1ɺ H51 yLB 6 H51 AIF(LFH H5K1 L1胲^LGS1ɺ H51 _Hݱ[HȱFH= 脨H1fDI~"aLR1ɺ 1H50 ٱeLA  H5p0 譱"L+-0AH%LڿALAu H= HLHC 1 H5/ 6OL葰OL?ÅL$`9L$@L$d9L$DDHJItDL$HE=t$X:Hc\$\H99Hi54<HHcH IHHH 99(Hi5Hl99H e99HL,5H$H$L$HIl$XfDAE8txI}uqI}ujAU4tIuE11LtMAE8IuMLL$t A}0 D$EtA}0 I@;5mH$Hi5H+21ɺCLKL~@ H5- PD$dP1%I~HSH3AXAYAHL1 1& H5- LO1ɺ H5- H IH=: H€KIL@ 11 H5)- fI"L#O1ɺ 1H5, 9Hi5H V7914t&JHcH IHHH5379*HL$L M…HL$HAHTHH9LMu\LoN1ɺq gL? ) H5/, q@<LI~1҉L N1ɺ 1H5+ #lL? 1ɺ 1H5+ 1ɺ_ Mf@LMH5+ ЬLnKHtHKL> 1g H5P+ 般sLLM1ɺn H5"+ _JH=tLH: LH€L@ 1ɺ 1H5* IAL $FADLݑL~L1ɺ H5T* 葫AL? 11 H5+* 1fAL> 1ɺ 1H5) 8ALN? 11 H5) 1HGEIL; H5) 1֪IF(1ҾLnIF(xlXAPLg7L{V7H=- 躠HHy44L4e5>L> 1ɺ 1H5( %P(0L< 12 H5( ܩLJ1ɺ H5v( 賩L+ I H5J( 茩MNL< 11۹ H5( ]L$XH$H$QL,DDӪUAWI1L9 H5'  ZHYL9%HD LL= D貭HHuH- IAtA1ɺ 1L}< H5M' 菨@L[: 1 H5)' fLL$ Le8 1gH5& 8DD$E|$THLz8 11mH5& Hc|$PHi511H=84H=* +Ht]H111IF(11LÅLXH1ɺ 1H51& nH=G 111IF(_W1L<< 1ɺ H5% $IF(-L( 11jH5% Hc|$7LHȿ ̫H5h) HHښHt)L; 1ɺ 1H5g% 褦AH5/) H蝚Ht)L; 1ɺ 1H5*% gAH5( H`HL; 1ɺ 1H5$ &AAIF(H$LcfH5&/9IL$)$Hi5H)$)$)$H)$T )$ )$0)$@Hi5LIH5.9HHA@LL$HHH-'2LUH,,Dm EASML6 AWH5# 1IF([]H$HcfLHHH5.9H$Hi5HA@H)$)$ HH)$0TH,)$@oILV& }MLt5 fLXD$D$D$D$GLA@LHHLH,R`L}IFaH= --b@SD؉[DAWIAVE1AUIATAUHSHfA]ΕHfIA]HDA u#'tn"ti1IELu8tHHt uDA tAFANl:t2Mc7LjE9aHD[]A\A]A^A_IAE9~IcHDDAWAVAUATUSH8H<$HHt$H53 dH%(H$(1H3IE1Ld$ H$ fDEu$ #$!!Hڋ H!%tDHJHDщ@HH)Hu$ @LLH@ADD$AEtdHT$ H=9$ HtbH=$$ HtHH<$LDŃAǃ"Ll$LH蕒H@L u,H$(dH3%(TH8[]A\A]A^A_Ð;8蔔LL$H  HALH5< A9HDHPHwP1RfWH rfDVfDƄ$RIٹL" LH5 1fD1L5 ^H5z 輟A1L5 _H5S 蕟Ƅ$RIٹLi5 FS誖f.ATAU1SjEA11HHtTHud6HN8蹐u H[]A\DH1^L?11H5 ݞL?1ɺ1H5z 跞DSH1H='9H8'8H88諌H[mff.fAWAVAUATUSHXdH%(HD$H1HH.AI/HH=! HHPHEHÀۅt; H= HÀۅt H= H1ۄþ1AԒuE18 A11貒u8 I1苒uѓ8 1gtJLt$$H=k LHL$HdH3 %(WHX[]A\A]A^A_fDc8 IuH5I:H= 舖H2HHuA}萐H5 H1ZH5-- H= =H&2HHEH=K 襖:H59H=C H62HHE H=4 eIvH=M ؓIvH=@ 胕ljD$ H=* HD$H=2 HD$ލIHuA1Hx @LHuL肔zL"4Et H= H؃AƒvnMD$H=<L€H= L€H IL$A]UIt$H=U =111 HHXLe0I\$AMl$HHHHHZLDHÃ1L/ H5 ̙Aٹ1L 0 H5c 襙MLD$HD$菎T$9;T$$;T$(;T$,LL$LD$HL$ t$Dˏ8IŃ-HL @0 PHqL  PHyH5 P1H f.[8贌LIo1PH&L / PH5S 1蓘_AXAIt$H=7 €H  IL$D111HH#L`0I<$MџHfHt$0AyHD$0ADD9l$$t+D9l$(t$D9l$,tLD$L$ HDt$cHD$0AA9|F1Hvt*轌H赝tH58H7 fDH>H ID$H=1 L€NH= L€/A8-11LB- H5w 贖f.1H膽6ɋIuH lfDA}WHL  PH L_ PHvH5 P1'H fDH= <H= XHHH= LH=s dŃ(H=j 譎08艉L J LRH59 PH3 PHvP1^H BD1LDS6A>H5; H1L+ 1H5 q8ʈL  LVH5u PHv PHWuP1蟔H ы8uL # LQH5# PH- PHuP1KH fAWAVAUAATUSHHdH%(H$1Ld$`Hl$pL H H%H[3H.H~HHLL H߉,HHg HڒRHD$\L=, DŽ$9LM9H,$DM$$M9Mt$Mt1LoBtL蓩1ɺMIH5a+ 1賒1LHHHuLSdLHHH1ɺUIL , H5+ 1_M$$]A^M9\H,$H$1HHT$\HH߹D$`#D|$\E:LM9tfDI|$Ht!.M$$M9u辆H[EuHf HV VyL+ 1ɺIH5#* 1uH1ҾH LHIH LA4 LLHt @H$dH3 %(Do H[]A\A]A^A_@HHHHԏyH4 H_ L( H5( 2fHsH^&1ҾH觔L01ɺIH1HH`HH 51H? H1HH߀H1Ҿ!H+E1HHHHH u8L/1ɺCH5' 1fEA @HH=A Lw( 1ɺH5.' 臎fLH5 ' 1\AL& 1H5& ,gHrLL' H5& A#LH5e& A踍HfH#fƄ$)$)$j31ҾHKH$HK&H$Hfo$fo$HHD$)$)$HCH{@HHL$HLfoXfoih(),$H$HH$p11ǢIHHLHmIHLH&HuH{HtLpH<$H@L-1ɺ1H5$ 'fL& 1H5$ L0& 1ɺ1H5$ ֋HT^HI9H$H-) L,$HD$L{0Ls(ILc CMLDMLDMLDfH{IHtIHL' 11t$H5# AWAVATAUH0HH9$*f)$)$)$)$DKEHH|$L# @1?.!IBHQ\HIFH1ɺ:ATI1L$ H5# \AZA[ HLd$pI9u>@M$$I9-1Ҿ!HIt$E1HHHuL*1ɺqH5~" ׉vLZ811L$ H5U" 詉L<$H$L2IH;$uDIMLM9t&IH1HRHHuLH$IL(H;$<HL$\Hl$@HHL$H\$HLd$ fDIELML;,$IIHt${8tDL$\EtH\$`IGHL$ L#HD$(H9HHl$0MHL|$8IIIMLI9IHLHuHl$0ML|$8HLH|$@HIH1PL$! IٺSH5 1_AXH|$ H\$HLd$ Hl$@Ll$`L5<# M9t4MMM1cH5h 輇MmM9u1L" 1ɺlH5> 蒇HD$pL8IH9u$f.IMLI9IL`H1HHLPH1LHHuLXLIǝAV1Lt" Pt1M$H5 ۆYL^1lH|$(#HxtLh! _IH5; 1荆,LQ'1ɺAH5 AcHHIHeILX 1H5 "L YH5 HL&1ɺt1H5q ŅdML 'H5G A蕅M1LF H5 Acf1ҾH)$)$Ƅ$#H$H#fo$H$HHHD$)$fo$)$HHH-Ht$HH'Hu(HtV>.tQ1HoHtBE1E111HHnt)HăuHu(H= H5T2E11jALfHjH []A\fDL H5 ~yAUIATIUHSHHYDHsEH-HHH@XH"H!L Hx1HHLL/HSHL5 L H- LkH[IDAT1L AUIaU@H5 1S1zxH H[]A\A]f11HdH+HSH- t6H-s6Ht6Ht6&fDL T L 91H5W wH[]A\A]DL1ɺYH5 wH[]A\A]ÐLy1ɺ\H5 wHLK1AT2H5 L Rw^_fDLMH?L fDHLKEATL  H5Q vZY{AWfAVAUATIUSHH8dH%(HD$(1)D$HD$ F%H*HZH~IL/H.lHt&HLNIHtHLm{H/&iH߾/HPHHEiHHPHEڀ}-E1<-+LA} hHI)hL9;L HHHHlI|$HD|$ZHD$HI|$H?HD$ H1LgHHkHD$HE1LHCH11PALSj;HLD$,H xD$ RfHU<-HAfDL 1H5 tHL$(dH3 %(H8[]A\A]A^A_DL DH31ƎHk/H[IHiHHLIHLHSkHMAVLa @H]AHfDL 1H5 s@fDLQ1ɺH5 isL4 H5 6s@HIٹAVL 1H5] rXZ_L H5# r,@HMAVL @IٹL H5 sri@AUIHATUHSHHYHs,HIċHu3HtNHLDtnH[]A\A]fHKI}AH8HHu1L1H5  qH[]A\A]DL\1ɿH5 yqH[]A\A]HLK1L H5 .qXZfAWAVAUI1ATA USHHdH%(H$1HHHHrH߉D$H57 f[]A\DH(dH%(HD$1 HD$H$u HD$HH]HD$dH3%(uH(q]AWIAVAUIATIUSLHAA@I@(HMLLPH2H8atPLLLIH`HC(H@Ht E1LLL$LLLЉŅAH[]A\A]A^A_D苠H*LC(HLLLAPŅuL1ɺM1H5' eDL1ɺV1H5 dtf.LLLLPŅLL1ɺf1H5 d+1L jH5 |dLL$LLHC(LLPLa 11_H5B 2dDL 1IH5 dff.@AWE11AVI1AUATIUHSH H6dH%(HD$1D$ jLL$[U_AXHHuHHIH|H}M~ HHZHEI _H1ɿLP1L H50  cXZHH1ɺLJHuHL$dH3 %(H[]A\A]A^A_I@t M}XBLm=IF(HULLL1PYH2H8S^HWELOH'(fL1ɺH5 b @M~ HEI ILy 1ɺH5 1aDL1ɺH5 a]@HLM1D$ H5z L P1eaY^~fDLML] 1ɺ_|Xff.AUATUHSHHVIH*H;H{H{H{ HIHHsH誗IEHtQHsH蕗IEHtHE HtIFXt/IL$LL$ILLLtD$uE@HH;$ufH<$IHfDLY 15H5| g[fL ZH5I >[atR@AUATUSHdH%(HD$1$D$FYHI1HDMLD$IHE{tp<$tjHXDELÉEv/M1PLW 1H5 uZXZ<$u71'1L %H5L LfL1ɺH5 V@La1ɺ1H5 E1tVLM1L: H5W LVH\$(dH3%(DCH8[]A\A]A^A_fD;D\$EDA1MLx H5 A@11UGfDLM1L H5 UGD$$H]4{1IٺL H5g A@11KUfDLm71L> MH5# A@11UHLkBH}kfDL1ɺ1H5 T+f.Li1ɺ1H5 TPf.L91ɺH5\ QTHIE1PH5; 1Lo T^_L1ɺH5 S-Kff.fAWAAVMAUIATIULSHHdH%(H$1,S1ҾH߉D$XD|$\e1ҾHAH߉d1ALt$h‰D$PT$TLl$pLd$xLd$PLMl$0LD$d1HMt&L+EHQHPLLDز0Hd$p t$\E11H߾HHLHHA1zD$\HH߅t EH$dH3 %(DH[]A\A]A^A_fT$XAHI L _ LEH1ɺPL H5 1QD$`A^A_1HhE1D$dADl$XD$(EtD$PH LHHtkD\$\EMLl$(;fDDT$(E2DL$XEuLHH:t&|$P1LLH-ufADLi 1H5 PL1ɺ1H5 APBLy 1H5 |Pf.1H薪HD$HLl$0fLd$0ImD$8HHD$H1H E1E11LhHQ1PjMH HImHHD$HD$,HD$fDLt$8HD$0M&MI9u&_|$XHD$0I$MMI9t>II~HT$H謳t DD$,EtLMMHD$0I$I9u‹81ImHmHt$Ht H{肃Ht$HA诫f.ADL1ɺhH5 AN\fDIvHHHD$0L$P1HʨHHL`L5L%F f.|$PD$`H11AVAE11UHjzH LH;AWAVAUIATUHSHHHLqdH%(H$1cf1ҾH)D$I)D$ D$0~[1ҾCH߉D$ k[H߉D$LHAzLAFAMt(H8EHOH$L$taHDD$ HE ML] 11lH5 ;LH$HTEt1HKHK$CHiKMtLTct$HH+KE111MLBD H5 lKMtH1HHMtQo]oeLl$I|$0)\$)d$ :=LAID$0H4H4Hl1MLC H5E @11ɃJAH$dH3%(HĘ[]A\A]A^A_EtIEH@@XqHIL}MB1L H5 %JH5YH8L1ɺyH5g I,HcI3 $-軯1MLH H5 @11ɃIHE`@X HLH8L AWZ1fLpI}1Ҿ4` XHHCLd 14H5q HQf.H#H)M1PL$H5% HM1L QH5 |H11AHH+QL1ɺH5 4HHkGWHKH= H1Z 1ɺdH5 1LE$HAMLD 1H5 EXZnM=1L H5[ D;@0ML H5) D fLi1ɺM1H5 Df.M1L H5 ID@MLC H5 D}fDL 1ɺaDL1ɺH5V C;@L H5+ C:@AWAVAUIATAUSHH(dH%(HD$1HD$BH߉BHBHBCHBHBi1H/HH HD$HHEmBEEMHDBHlH/Bt%H5QHA0HVHE11DPALHUL%D|$ Dl$$AXH[ ZE)LAHDALDHT$1ELC H5z @H11HT$RAUATAH HH`DHL$dH3 %(6H([]A\A]A^A_f.@HAEfLi 1H5 AFAfH@wfL 11H5| A@L 1H5F A@fL\ H5 A@7f.@AUIATIUH1SHH1H1HtIT-LHntI$H[]A\A]fDH߉D$ D$ H[]A\A]DAWAVAAUATUDSLHL.LfD~DVKD%L9HX DT$ EPHE APL 1H5% Q1jo?H 11AUA jL H5 C?AYAZATj11AL !H5 ?A[XAWj11ɺ"AL H5 >XZDT$ EAD\$ sARL 1ɿj1A%H5W >M_AXD\$ twD\$ H,1jAL 1H5 o>XZD\$ Eu< IIuHAHt$ LLL$L$EL$LL$AL;L$t1ۃ|$PHD$@{H8HD$8H|$0H8H$x dH3<%( HĈ []A\A]A^A_ÐHcEBL=HÃ~IZDl$TDLELL$XAAAztUH|$0zH$pEIDHD$f.DH;D$1HHH|$HAHcHT ttHH=uܹDt$pEkHcAIč;D$PALl$0Ll$/IHT5E1\$ D1DL$,HM1fDA HcŃDpL9t&EwIEtA tuA uL9uHc͋\$ DL$,LDqHL$Ht$H H|$IcDDL$ @3DL$ H|$0<*L1ɺ 1H5 71DH|$0HHTHTAGH>fD#L-H EDHD$ (D$TAݍC9D$P[D$TtwHT$XHt$HDH|$0r2&H|$0s)L1ɺ 2L 1ɺ UH|$0TTTH|$0fTrD5.DAUATUHHSHHu[HtFH1HMċ;I/H9u,;LL'HxI9H[]A\A]fH1[]A\A]HHL[]A\A]ff.AWIAVAUATUSH(H|$xHL$HLD$`LL$PdH%(H$1HH5 HH/HD$XHHD$`fE1HDŽ$)$H-)$H D$lHD$H$H$H$D$hDŽ$DŽ$HD$p@HD$HLI9EIcH;D$~L$1fL)$HH$)$HD$ HDŽ$DŽ$DŽ$|$hEl$EEA EAGhZHD$PH<$H$N01HfDADڈD< HHuH<$H$LL$@LD$8DT$0D\$(BD\$(DT$0LD$8LL$@H4$LϹLHc$DT$8D\$0LD$([%H<$D\$0I1DT$8LD$(HfDDшD< ]UHHuH4$H= :H<$Ht$ HoOO&G*o_N fF$1))^H) $H<$HHHt$p< tt HHH9uH4$DT$8H= LD$0LL$(H<$H$D\$@H5+&D\$@~AGtLL$(LD$0DT$8t$A9G8WD$h$HT$`ADL9A8wLHt$P<HH9wL)HL$(=v0Ht$P|HHPH9uHD$HLX 1ɺ7H5 D\$ M 12D\$ HciD$h t$lu`H|$Xt H|$X-H|$X)ulH$dH34%([H([]A\A]A^A_fHcLq 1ɺ1H5 W1zHD$XHL 1ɺ1H5 #1nL1ɺ1H5 0:IٹL H5 01!HD$(QHD$0L)HD$(H|HiD\$@HL$L$D$HL$8i(D\$@HH$HD$(HL$8D$L$HL$HLHHDT$@L$H$D\$8+HD$(HT$0HHHD$PH*D\$8DT$@H$L$< D$(u| u1| D$($H$fo$fo$H$)$)$H޿ϦD\$0LL$@DT$8lLt$HH1t$($Lw H5 RLL$XIAQMP1U/H0HHߋ$DT$8H$HDŽ$DED$ZD\$0D\$ M1ɺWL2 H5B .D\$ D$(0H|$xD\$ .D\$ t'H5D HD\$(d"D\$(HHD$ H|$Xt2$Dp|Ht$XHD\$ "D$D\$ HD\$  HD\$ yHH ADEDEZH$D\$ !Ht$ H$H$H3VH3H u/H$H$H3VH3FH uHF H9$D$lML 11YD\$ H5 ,-D\$ 1D\$ HI1AV1ɺL" H5 ,ZYD\$ HLHLL$@HL$8DT$0D\$('LL$@HL$8DT$0D\$(HL$XH= D\$ z&D\$ ZHL$(H-HD$0HL5F`1LHHt$ B0 tt HH=u޾ LD\$(!D\$(Ht11MbL0D\$(H5 +H|$ H5 D\$(HH1LHB0 tt HH=u LD\$ \!D\$ HtMLIC 11iD\$ H5 V+D\$ HD$0HL$(t"@SHHdH%(HD$1HH$u4H$H HH%H)Hv?HL$dH3 %(uTH[ÐL1ɺL1H5` *D1Lo1ɺRH58 *1!ff.SHHdH%(HD$1HH$Xu4H$H HH%H)Hv?HL$dH3 %(uTH[ÐL1ɺ71H5 )D1L1ɺ=H5x )1 ff.AWILAVIAUAATIԺULSLH(LL$Hl$HdH%(H$1LL$HHufoHD$IGϦD$HD$@AGLL$0D$$H\$(HD$8D$HD$LHD$PHD$XHD$`XfH1ɺ D$AGLLO AUH5U P1Aw(H11AU IH5& LH s(XZL'L'u&L?H=4 H1r1nIOIWHLHHL¸uNL  1H5u '1&1L 1ɺ H5P 'H$dH3%(u]H([]A\A]A^A_DH1H5 ES L I'Y1^L\  SeDLVM9wbfH1IL* HH5 HR AQM&1Hf.AWAVAUATUHSHHH<Iƹ 1HHLkE1L% fDIcDLLH1HAI9uAoAoNLAoV Ao^0Aof@AonP)EAov`Ao~p)M)U AoAo)]0AoAo)e@Ao)mPAo)u`Ao)}pAo))))))))HH[]A\A]A^A_L 1ɺl1L H5 0%ff.AWAAVAUATU1SHxH|$0H$L$`Ht$8H$H$L$D$L$MLL$L$H|$ Ht$(LHD$dH%(H$h1AI@D$HHD$PHD$XrEIt$Ϧ1a;$`H5A%r0N*>I3T$ H LVM2 x[H3$dH $H|$D$$tt0HL A1j1H5q #_AXL;$xt/H1H5O AAUL 1#Y^H$H9$H11ɺ$AL H5 >#XZ|$HD$$D$H1ADHIM(It$(HD$XHD$`HD$PPHD$hPHD$hPL$HIM@AD$PIt$@DAjjjL$H Lt$PMX|$EH$SHHHt$(H|$ ILH$:jHT$Ht$8ILL$H|$0H1H$`H= HA1PL 1H5Q !AYAZD$fHALJ 1PH5 1g!A[[,f.$-1H|$LUH$HHHt$(H|$ ILH$H|$H5 IHH$LHHHt?Hi1$LL$ L H5 m A]A^$HzLBL,$؃DD$HD$LD$HD$XHxH$IHbH$KT5HT$LH9$D$Ht$(MH|$ E)LLT$0LT$0H$IHt$(OH|$ HT$8D$0+$F,0L|DL$0HALq 1AUt$Ht$AVjH5 +H0L?1H$hdH3%(cHx[]A\A]A^A_D|$MW1fDHALJ 1AUH5A 1A1ɺ$pL H5 $1`XZI|$Ht$`HA1PL 1H5 &A1ɺ$L H5 $1Y$AL 1ɺ1H5} ^$AL 11H5L _AXGM1ɺ L H5 n1QL)1ɺX1H5 ?1"HML 1$\H5 HZY@L,$HT$MHt$(H|$ LkEH$DLϦE1M4A(ZD$ 9D$t3jL} 1ɺULL$H5( 1AoAYAZ11譴D |$HHLLH~HUH L2MtLH$H$IHzHtHT$LH5 ľH̹ELL H 1EHML 1$[LY1ɺW1H5 of.L)1ɺr1H5 ?f.L1ɺp1H5 f.LL$1L bH5 H 1L 1ɺ1H5P AEkD$LH1ɺL$ H5 PH: PD$8PLL$(1VH D$1H|$H|$H5 IHILHLL8L1ɺ1H5 f.HALb 1ARt$t$AVj\H1ɿt$LL$L AH5 `_HAX5E%1L41H5 LwL 11H5 D$LMLH1ɺPH5p Lj AVD$8PLL$(1H t$[f.4$AL 1jH5 1gA[[GHAL 1t$1AVH5 j/H LC HEtmD$L1L5֛ L1ɺ1H5 LL$L 1H5Z E1AT1 AUHHSHH EL$1Ҿ?HLDH8LBDG@DΈ HJI9uH[]A\@AWAVAUA͹ATMUHHHSHH HxH$LL$8HD$H$HD$H$HD$H$HD$0dH%(H$h1H$`HT$ IH$ E1AHLABELONEH9$`.H;$hH$ϦHpS;$pL$t HLVM2 001H9$xMt EtA$ESH$H|$@Hp D$,U\$,H$HD$ HXH H$1L% LpHIHD}I>DEtHAM1SMH5 1]YA6AL 1ɺO1H5 5^AvL A11QH5 _AXd@EHMfHH+D$ H$I9t$AL 11iH5h E1I~9Lt$8tfHL$IHIHHt:H=t2HH5 A1PL 1Q^_IHAI<$Eu)I$ID$EwH|$HL$HHDHAL 1SnH5 1AXA4$AL 1ɺp1H5^ AYAt$AL 1ɺr1H53 AZA[PfHD$0Mt$D8EH4$HH+D$ HDI9t!L 1ɺ1H5Կ #HI|$Il$AL5 HAHH}EtHEM1SH5j 1_uEL 1ɺ1H5@ AXuEL 1ɺ1H5 fAYAZeDEH$hdH34%(D$,Hx[]A\A]A^A_fL 1ɺ1H5 A11L= H5} $t fAL 11H5= $@LQ 1ɺH5 a@HEL 1SH5 1/XuEL 1ɺ1H5 Zu1E1H5 L Y^HALJ 1SH5Z 1A[A4$AL 1ɺ1H5. }A_At$A1ɺ1L H5 RHkHH+D$0HD$ZYI9t!L 1ɺ1H5ʼ I11L H5 EL$11Lu H5{ EL$11LԾ H5U @HD$ L9 1ɺ5H5- LH 1vH$Ht$`H  Hx 1L 6IH5 14L 11L$7H5 fDHELz 1S[H5 1A\A6EL 1ɺ]1H5_ XAv_1EL 1H56 XZfDL 1ɺ1L H5 KJfDL ̼ 1ɺ1L9 H5ɺ E1LL$ L 11H\$`H5 L<$HH һ L21L̻ IH5Q 1 11L L$hH5! u 11L D$pH5 L L 11D$tH5Ϲ # IHH {L 1ɺIH5 1 TfLL$ L 1ɺH5m  D$,`H$E1LpHff.AWIAVE1AUMATIUHSHHXDL$ dH%(HD$H1D$$HD$(HD$0HD$8HD$@ DU\EHD$$DT$1E1PLLLHD$HPHD$HPHD$HPLL$HH L$$E1ۅDT$AÅAAt5E(HL$HdH3 %(HX[]A\A]A^A_@HD$8HL 1ɺH5 ; fD1ҾHIH1낐`H HD$$LE11PLLHD$HPHD$HPHD$HPLL$HH T$$E1ۅAD\$jHD$$Pt$@t$@AU1MHATD$HߋL$<]H0D\$1L. H5 H 1D\$jHT$(Rt$PP@1LQ 1ɺH5  nD`HFAfAWAVAUATUSH8dH%(HD$(1H:HD$HD$HD$HD$ $D$uHD$Dv\MIPHHI11LHD$(PHD$(PHD$(PLL$(LD$ \$ H T\$Eh<Lz 1< H5 L 1= H5r HT$(dH3%(!H8[]A\A]A^A_AtAtLAJLD$MZLL$LLL2Åtf.LD$1MpLL$ LLL FfDL 1ۺ( H5 1L% 0 H5] L 11 H59 H}lH}aL 1ɺ7 1H5 DLD$MLD$M1DL 1B H5 C L H5{ 11LP 1H H5M I L LL$LLLLÅ8LD$Mf.AWfAVAUIATUHSLHhH|$H$LHL$H dH%(H$X1)$)$Ƅ$HD$XHD$`HD$hHD$pHD$xHDŽ$D$PD$THL$蛲cH$11HH HD$ HD$PPH$PH$PH$PH|$0L$LD$tH L$TD|$PEu_HD$`H D$pEh<J1H5 1L H|$ D$PEl?HD$pHt LML9 HD$xLM Ht L9 HELL$xD$PHD$pL$PHt$HL讯 EtIU < H H$fMuM}It$ H)$)$Ƅ$)$)$Ƅ$)$ )$0Ƅ$@HDŽ$HD$8谐D$(f)$)$EtF D$0fDupEfDHL 1ɺIH5߯ 1,L 1ɺH5 y@fo$fo$)$ )$0EtD$(D$0LH$L9ADž H|$H$I3T$ H LVM2 x[H3$TH !H|$ BHt$ HH%H-H)HD$(HHt$0yIH!HT$0Ht$(HHH5A%r0N*>I3V H LVM2 x[I3FH sA~AHD$(I;FZHD$0H %H LIuLt$8LD|$LIH\$@IHf.HL9ooLLo o0o@op)$PooP)$`o`)$po)$o)$o)$o)$o)$o)$o)$)$)$)$)$ )$0)$@%HLt$8H\$@H1Ld$8uL 1H5 ATL|$8MLL$L$D$`XZLM9t-@HHM}HIHtMmM9uH|$ EtDL$(EUDD$0EWL8 H5Ƨ 1E1oM 1H5% tLL$L E1 H5 >fL 15 H5  6 L fD1H=/ BC1ɺ1H5 TI51L H5ޚ -L1ɺ^1H5  LՎ1ɺ fIW8H5 L L1ɺ1H5d ZfD$HDLLcI9Lt$@HD$(LHxW$H$@Hu(D$TfDIWH5L]txL1ɺ1H5 fIWH5IL$H71Ҿ3HHD$$HIWH5LDŽ$L@MW1L H5 I8@iHuhHD1ҾHH$H H11Ņ|H$ƿ8 L$ L$MI|$EH$HLHƉHH;$'L$1La H5 KH$^L1ɺ @L1ɺ1H5 fL1ɺ1H5 vf.HAjLD$XHL$LHHT$(A]A^2@IW0H5ɹL\$THD$HfIW H5L]L1ɺ1H5 fDIW(H5ALL1ɺ1H5l bfDL $L H5; 3DDŽ$PH4$H$L#1ɺe2$%= H<$TH{HpHhSHD$HHTLt$HHH,$I~H1H1AHT$L fH=b HNIW\H5 LLO1ɺ11H5 e H4$H.LH4$1H'HD$H$THAj[Lш1ɺ1H5 fH|$L # IH5b 1LfDH|$NHL PLL$( 1H5 `A_XHHD$hHD$pHD$xHDŽ$D$`D$d\ 1ҾHHH>HD$d1PH$PH$PH$PHT$hHt$(H|$8L$L$z$hH  L$AM¨ D$<EkLʬ 1?H5 =L 1*H5  L $L H5 -L1ɺ H5b slLu1ɿH5> HT$U1ҾiHaHR H= f H€ H=e H€Hƹ H=z LD$HL$LHH$RL1ɺY cDH$HLHILƔ P +fDL $ 1L H5! pL$L# 1 H5 <HE1jnfL1ɺhH5 1HT$HD$H@H|$螵HL P LL$KfDL$L 1 H5= ILI1ɺ 1H5 _+f.HPH$H$L$H$A<$#AHc= I$HIDP t)IT$DP tH5xLHt@A# A|,u A|, L 1ɺc 1H52 Ht$xLT H59 LmH)oXHH$o`$@&$A$f$$H$ϦH$$H$H$H$H$H\HIٺ PLБ 1H5Q XZGfL$L` 1 H5 d!L!1ɺ DHD$hE1D$hHD$pHD$xHDŽ$HDŽ$PH$PH$PH$PHT$hHt$(H|$8L$H DD$hEZ j1@LE1E11HHD$hP$$t$ht$0YH0; H$Ht|jE1E11LHHT$lR$Pt$ht$0 H0D$`t8T$dt09t,Lè 1ɺ1H5 SL 1H5n @HD$dH|$11HD$pHD$xIHDŽ$I HDŽ$D$hPH$PH$PH$PHt$(L$L$H |$huCH|$1H5 IL͝ 1H< H$H|$LH' HuϦHLABELONEH$HLVM2 001H$HD$DŽ$ H$1H5 A$1L EHX Hsu#H|$H=ҍ H1d( H.#[T$<LHD$pLl$1D$(H$HD$\L$HD$HD$hHD$ L|$ILPLl IH5 1iD$(H9l$<@HD$HHL$L IHHD$p11LHD$xLHDŽ$HDŽ$D$TD$XD$\D$`D$dD$ht$ AVH$PH$PLL$ LD$(tH T$\E1HD$pAH6H$HjL$H1ɺAUI1Lˤ H5 :AZA[D|$`E3|$dE1ҾHIHL{1ɺ 1H5 U H=ۋ L€LH$H$HHDŽ$HDŽ$ L H$L$HL{1ɺ 1H5 5H1H5ʆ 1$L$L Y^HL 11$L$H5m AXAYfo$$Tfo$$$,L HMPH5 z 1Lo MY^Lv 1C H5Ӆ "D$PE1E1HT$dE1E11RHHT$`R1$PjAWHt$H賳H0D$\AP1E1,L$D$<M!E2M ALL$hHD$pM9MHL\ 1ɺP1H5 1XZHML 1ATH5 1LA[IXMHt$HH|$MLLQHMMLLH߽MLNH|$LD $D $IAOLL$xH$M9&MHL 1ɺPHT$`E1E11RHHT$\R1$PjAWHt$HH0D$\Ad@ H= L$L [ H5d Lћ 1\ H5E @H$LLw11 H5 b.L 1ɺ{1H5 7H$H8@I 1L̆ H5 t1H5 1L n HH=Ǜ #3L 1 H5" qLL-t1ɺ1H5 CLt1ɺqL g H5 tI 1L̓ H5 /L 1ɺ1H5h $LD$LHH$HL$HKLD$HL$HLHL,s1ɺf H5~ ?EA=A1L- H5~ ~EAArL$MfH|$LD $臦MD $IuH|$L.AIƋ$P $LL2 1ɺU1H5~ D $\D $EMM-E1H=o  fDH5 1H$HdH3 %(HX[]A\A]A^A_L ,DL H5 ~lHyH$HD$`gfH~fDLL$(1L OH5 DLHV1t$0LL$@L H5 XZLig1ɺH5 L9g1ɺH5S Q_1Lj" H5# *Mf.AVAUATUHHSHMHI OH߅P MIľHKcHMHNugHu61HHH\[]A\A]A^fH([]A\A]A^f.LHI+1-MLr H5 @H11ATXZOfDHNI*1M)H5 L @H11AVYH^MYfLHALHALE)LLHHM1PL< 1#H5 _AX[]A\A]A^H []A\A]A^fATIUSHftjHUu&HDuH3LA D1H5a w[]A\DH;H& HMHHqHHmHXHCt&H2WL! H tHuxHtH1LE1AH0HPjcZY@LE@ RxfLH[]A\鏺L \Qf.AVIAUIATIULSHFPHH?HIHtVHsHI<$IEHt@oEoKMoS U o[0]0HC@[HE@]A\A]A^1L* SH5 $[1]A\A]A^fAUIATIUHHSHHYC@G LH&HtALC HS(HK0HH}t C8H[]A\A]LGH&1ILd H5O @11ɃVC8H[]A\A]ff.fL`1ɺ&1H5 ff.@AWIAVAUATUHSH(LqH|$HH4$dH%(H$1FI^IHIF1ɺ.H5t v1Ls "H5ct DH[]A\A]@L=1ɺ2H5+t H[]A\A]ÐAVAUATUSHH dH%(HD$1AIվW1#1ҾWHˮHHD$H$V.1HHHHE11DHEALHH>PU=Dt$Dd$AXZCE)1EH5Gs ^@H11ATLr Y^HHDHL$dH3 %(H []A\A]A^Lqr 1@H5r A讛@L!f 11FH5r A|iL 1TH5kr AF3|f.fAWAVAUATIUHSHHHYdH%(HD$81芚tH#nLitH#MCH#aH#HA"LLkH!LI DkE7H{(S 1虈LܙtNL|$(HL%Cs MMH{(H=q H1Ls(A2H"#H"!LHwIHE`H-c HtHh8[1EcH Lp @HH5p 1ATUP1SAV|H0HL$8dH3 %(HH[]A\A]A^A_ÃH HCHy HCHSHsLfsCI|$F4Cs CHHC(H{Dkf. H;!HD$?!HA t$LD)H?HI!HD$ t$LL%a HHHE`HtL`8HHT$![HGAWHT$1ELju R@Ǻo1ATH5:o 1USAVH0fDk Hq HA D)LHuHI: HLHPHI HAW1EATLt hS@H5n 1AV1lH [1M=LxKH5an @111@L71ɺQH5.n @L4n 1WH5n ܖ_fUSHH $HH> dH%(H$1HH$H$IHH m HOILm 11H5mm CHH޿賎ItD1Lm 1ɺH55m  1H$dH34%(uiHĨ[]@Lwm 1ɺH5l ɕfH11UL m Ls H5l 蓕X1ZȌATUSHH $HH *m H= dH%(H$1HIHIH߾x~11ɺH59l ILl 1H߾ǽ蒃u~H$dH3 %(H[]A\fL3tH1UL Ll 1LH5k mAYAZ8D I1PH LjPH5Nk 1'XZB諅ULq 1AHk H5k P1_AXkH1IًH5j 1Lk P1讓Y^fAWAVAUIATI1UHSH(HL$H\$@HdH%(H$1HHTAƉǺH誃DI߁EBMc1LLH5-HBD<.tYILk 1ɺ1H5i Ւ1H$dH3%(JH([]A\A]A^A_f.H߾ cHHxHPH=j H HHtH|$Hs胊Vf諈8I1PHw LhPH5i 1XZEILi 1ɺfDILi 1ɺf.1ILi 1ɺH5h |譈ff.fAUATIUHHSHHLiݥtH[]A\A]H踥uH,Ru1ɺMH5h L=i HHuHUt9LL"i 1H5g 薐AET@H HLn SA1H5zg PXZff.AVfAUATLUSH0HdH%(HD$(1)$)D$D$ I9tMIIHHAEL9t-HCHo)MoP)UuHAL9uHD$(dH3%(u H0[]A\A]A^Ć@AWAVAUATUSHH $HHH g H7 LdH%(H$81Lt$0HILL1 AŅMLg 11H5f IԎI$L9HL= HI9tqHC !Ho)EoH)Mf|$ DHy8`1MPH5~e Ld1AWIHY^I9uD|u~H$8dH3 %(0HH[]A\A]A^A_H胍tH1A$L Zf LH5d 踍[1]f;8蔁 M1PH LdPH5d 1wXZBI$~Lj AHe SPH5Zd 111AZA[諃HM1ɋLe 1H5d P1AXAY AWAVAUATUSHH $HdH%(H$1I~HHHL-4 E1L=LAHHHz.tLHHHHMMRH1踅H}_AXt贂8tlI1PLbH5c 1AWYH^wHHgHu,H$dH3%(uVH[]A\A]A^A_+8oM1PHLbPH5b 1gXZ螂ff.AWAVAUATUSHH $H@Hn8H|$H$IL$H$HH/3 dH%(H$1D$(D$,HHH >b LHD$I1虑HI@H IH\c H%A DD$A1QADžH $Ht'HcHc 1H)H!ALHM1PD$(Lb H5-a P1AUH 1L}ŅEufA)EIcHމGy>LD(H`1ɿLh AUI1AVH5` xAYAZxuH$dH3 %(H[]A\A]A^A_8HH|$蠈L辟Lg SIAV1H5_ ԈX1ZkH|$It%Ht$L ` Lzt$Lf AH_ H5_ P1XA[1[fDH\$01HHT$,Ht$(HHLD9l$(5H|$藇T$,LDt$(T$語HryT$Lg AH5^ RAVD$(P1AUt$0U訇H0|$0H4$HH~H|$LSIt$L,g Xu}8 {M1ɺPH L]P1H5^ _AXH|$aL聝Ld ID$PAUH|$!LAH1ɺt$ID$(Ld H5}] P1AUNH DL+HwHLd UAAVS1H5)] H 1@;yM1ɺPHL L\\Pf.{HCwHLc AD$ PAUS|fDCH w4$1ɺAD$ Lc H5w\ P1AUULH Dt$,l$(LHLd AVIUD$0H5$\ P1AUt$8H0ID1D$9D$,H1H5[ ED$ Lc P1覄Y^:ZH"vHLd SAt$U]{f.AWAVAUATUSHH $HfLH|$LdH%(H$1)D$@)D$PD$`M9HD$pIHl$@HD$HD$H6LK 1ɺ<IH5~I 1RrIGL1PhHD$(|$81HLL羃qH߅ HcHLW SAH5H 1q[A^HaD$HIULL;,$uO@H$dH3%(D$HHĨ[]A\A]A^A_Dt$4EIULL;,$tIDHt$hHS A$ HD$hIvHHHH=c$1ҹHL*L羃_pH߅TL|J 1ɺ\IH5G 1pFfI9uIvHdfDkHANjT$ tH=7[HfDaLS +AH5@G 1pD$HL羃oH߅裆HkaH1ɺ$SALI H5F 1oAZA[HD$(7L羃#oH߅tlGLH 1ɺIH5F 1cofDLH 1ɺ$IH5[F 1/o|f.ۅH`H1ɺSALUR H5F 1n[]yLf 1ɺ1H5E nDL$EAHu~EtyL,n4L}U 1ɺ1H5E snE1LmHT$`H5H 1 ^wfDHA  Lt$pLHLLHHLxt$0lL$<H\$pL9af.H{GLH 1ɺIH5D 1mHL9ufDL羃mH߅#L8G 1ɺbIH5kD 1?mf.HHHT$`LL$`MLvG 1ɺ1H5D l L羃[lH߅({LF 1ɺIH5C 1l?fL羃lH߅83LyF 1ɺrIH5{C 1Olf.HH]H1ɺ<UALO H5.C 1lAXAYfDD|$<D$4H<$9}H-!7D$<R@L羃;kLH߅TH1ɺEAVI1H5B LE jkY^\LtR 1ɺAH5cB 17kfLQ 1ɺ1H59B kHL$\HT$XHI|$LD$`D$<D$\fD蓁H[\H1ɺbSALO 1H5A jXZHSH\H1ɺASLD HLfD$\HHT$`BLiD|$\Lt$`Hހ1ɺH50A AWI1AVL+P iY^D$<HhUM$LHyL*N 1ɺkAWI1AVH5@ iA_LXiH߅1L^C 1ɺlIH5y@ 1MiHZH1ɺrASLM cLt$`HH1AVI1LO H5@ hXZ$fHSZAVLL 1ASEf.LL$`LAC 11H5? zhD+HYH1ɺ\ASLuL ~L/M IH5@? 1hFL羃gH߅~IzYH1AVA1LM H5> g_AXD$ D$T$\HL|$`T$ [~I#YH1ɿT$(A1LM H5> RAWAVbgH D$<L羃fH߅}L@ 1ɺMIH5;> 1gf.L羃fH߅}LA 1ɺIH5= 1ff.L3fyHT$`H5KA 1SVfDH\$pL9f.H{L͡1ɺIH5_= 13fHL9ufDHH\$pL9u>@胀L@ 1ɺ'IH5< 1eHL9ZH{G[tDL@ 1ɺ)IH5< 1efDC|H WH1ɺMASLeI |HVH1SALL H5Q< 1*e_AX2LL$`L? 11H5&< d8L11ɺL`J H5; dLLHD$\\L8dL1ɺ1L> H5; xd.{L> 1ɺIH5v; 1JdLct&LC? 1ɺ#1H5=; dULK 1ɺ#AH5; 1czHcUH1ɺlASLmH L LJ H!> H59 LD11b1HμHHHD$1LDHEE1E1HHAPUAXZL$Ht$ H~T$Ht$HH+t$ HD$T$~Ht$HDl$ID+l$~DL$ID $1L)J H59 @H1HL$QT$1RAVAUAWDL$0aH0HHBHL$HdH3 %(DHX[]A\A]A^A_@H afDc1LbI H5l8 @11 1ɺl1H5, AWUfL1ɺ^H5V, A+UfDHH50 MgHTD$~KT$+HL 0 LAPH5+ 1TXZ fHH5 -  MCHTK HL , LǬPH5]+ 16TAZA[DHH5+ LWHSD$JT$ HH5* L + PL<1SY^HH5+ LkHSD$JT$t HL * LѫPH5g* 1@SAYAZL< 1}H56* AStH{(蒊H T$jL1ɺH5' PFHSPLkU1H5' AP@LgLI1ɺo:DL, 1ɺ1H5q' GPfH=, A?fHt8LAm H=T7tLRw AL, 1ɺH1H5& OHA@J3AL9 AH5& 1|OALy9 1ɺDLd$Hl$ Ls@Lk@M9Hl$L|$InT$8H\T$AT1AWA1L( H5# LXZLl$PLt$M95DI} t*H{H IU HHHPMmM9uLl$PLt$L;l$uMmM9I} uI}HtH@HH  aLl$`Ld$ I9t!fHIU1HHPMmI9uLr6 1ɺ1H5" K{L|$`HD$1ɺ H5{ VBL1ɺH5\ 1A*BqL㾃Ld$HAHL $L/ 1H5  AA#b3L[. 1ɺARAH5 1t$AAA[]Lc1ɺD8 3APALQ. t$H5~ 1RAAZA[EH@UD$XL. H59 PLL$1AXZH@L $L. 1H5 @K2L. WA1H5 t$A@AXAYLK1ɺ,L81ɺ H5u P@l$P1L- UAt$1Lj- WAt$H?HD$t9L1LF H5 ?D$0AH:1H5 RAL@ U1?Y^ff.@HHG(L(` H5l DHp19?Hf.DHHH Ojf.HHH oJf.LU]Lu\L\L\ATIUHSH>u HItLHH H[]A\L^@[]A\ff.ATIUHSH=u HtLHH X H[]A\]@[]A\ff.ATIUHSHU=u HtLHH  H[]A\]@[]A\ff.ATIUHSHtVDH5H,¸t!H5UH,u+EH[]fD@fH5"] Ha,tMH5HN,tRH5 H;,tWH5 H(,udu'@EH[]fDE[u˸D91IL* -H5* ;AWAVAULo@ATUSH(H_@T$ HL$LD$I9EAE1E1$Af.HL9HkHff.ATIUHSHdH%(HD$1FHtluWHt$UfÅI$L$9tGHL$dH3 %(H[]A\@tҋFuI$HxGPL% IH5# 15ELI1ɺ1H5# _5_,DF\u fUHHSHHuZC[uTHH-{# 4H߅H:% HDOH1UILC% 1H5+# 4XZH[]AVMAUIATMUSHιHdH%(H$1Hl$HHHC@[tHEAHHLH{G[t1Ht'HT$ H"D$ H{fHLHK1M@HQPtbHIE1LjUjH H|$HHtfH$dH3 %(HĠ[]A\A]A^fM&HHJHAXH$HEHEUDL)1ɺH5! <3mL1ɺH5g!  3=L1ɺH57! 2 *fLBLJ1ɺLBLJ1LBLJ11ff.LBLJDAWAAVAιAUIATMUSHHLL$Hl$ HdH%(H$1HF[tHDEH虵EDHHLeC[t7Ht-HT$HHMD$fHL51MHSP@tfHE1E1HjLUj<}H ۃH|$XHt^dH$dH3 %(Hĸ[]A\A]A^A_HD$L fDHH@@\HEXL1ɺH5 0jLy1ɺH5 0:'fLBLJ1ɺLBLJ1LBLJ11ff.LBLJDAWfIIAVι/MAUL H ATUHSHLj H$0H$H$H$Ld$`H$dH%(H$1H)D$0HD$81MHH$IEHH$H$H$H$H$H$H$H$H$H$H$#H)D$ H$L)D$)D$@HD$PHD$ `L$L$L$(H$0HHLH$xH$HH$H$HH$H$HH$H$HH$H$HT$H$UHDŽ$8@$H$HJxH$H$H$HH$0H$8HHDŽ$TH\$hMLLLBH}1MLEIM@HMLLPATUOyH H$Htq`H$dH34%(H[]A\A]A^A_fDH}HT$rHT$1MLEH@IjH$L3^L1ɺxH5 ,TLy1ɺH5 ,$#fHHAE1PLIbHff.fHHAAPLI12Hff.fHHAE1PLI1HHHAAPLIHf.SHy1HH@t9HE1E11jHjjwH t'H[Hyf.L91ɺSH5 Q+[f.HHvCEEtHH !u=HHHNfDt[@HH PHH$@EAEt H Ett H EuH EEHRI11jE1HEZYHfD1L  GH5 $*1HDHHHH2fEEtHN|EAEtHE`tH?ELH@f.EAEtH-EtHYEH)@AVAUIATUSHH >dH%(HD$1HT$Ht$tLd$LGHH@A|,_HDHtaLsL Lm8AąD+A}t~Ls(AHL$dH3 %(DH []A\A]A^D L 1E1H5 v(@HFFAHF(@HD$AHC(x@L 1"H5w (KRfAWIAVI1AUIATUSHdH%(H$11ҾLAG1ҾLAG1ҾLAG ~1ҾLIG01ҾLAG$1ҾLAG(AG,IGHtPA@<AAF0~5H0>@!HH4@HH9@H9uIoLHÅOA=A =p j==$ 1ҾLLIF8$&1҅ L]IF@fA>vfLHDŽ$)D$`)D$p)$%_IE@HD$I]@E1H9\$u6sAA A@HH9\$BHkHQ'tݾH@'t1ҾH-3A>HAăuLc1ɺ1H5 y%LB1ɺ<H5 11V%uD1ҾL LIF8$1҅ LIF@@@_1ҾLLIF8_$1҅% LIF@?1ҾbLp1ҾcLIF8]1ҾdLIF@JIFP=1ҾL&LIF8#1҅k LIF@DAF01ҾLaIFHrH=> VHD$8HA A tIv@H|$8Hm2LK1ɺgHD$`H IE@IM@1HL$HD$H90ALl$PL|$HLt$(MD1ۀ#5HL$(AADHD$HHD$H;D$HD$HXHR$tξHA$t*1ҾH.0HHD$(8Aă 1ҾH0H+-.HL$(HA0@1D _A~  WIcH HJHL$HHѐf.1ҨD 8A~ 1ҾHB/IcHH4HrI׀H9\$A61LL@E1Å,IW0qL[&qLIG0 tAGL tAGL  ML tAG LL tAGAG$Li tAG(oLK t8AG,.DE1Li1ɺ1H5  H$dH3 %( HĨ[]A\A]A^A_@L1ɺ?1H5 / DI8H|$8H2jHD$pHH\$8IHjHH$H|IHiHaHD$xHtWI@HiHD$ D$ ====+1E1L% H5 @H\$(dH3%(DH8[]A\A]A^A_f.IV(I$HBHtD$ 7@=aIW8HDL$$DD$ HL繀Af1ҾLIvHHt0Hxu$L H5 fAW@A>D$ tI$HBHH$HEtYwI|Lh 1H5^ At 7IW8DD$ DL$$H;HL{AH8)ADLY1ɺH5 q@L11ɺ>1H5 AA@HL H5\ qLɳ1ɺDH57 AyfDEE<H}A`Lv1ɺFH5 AIW8HDL$$DD$ HLAqIW8H#DL$$DD$ HL@AAIWA7HLLbAIW8DD$ DL$$HHLAfL1ɺH1H5 A7@E_EHH6HDHIWA7E1PE11LjU蓝H AgE/EHHFHDEN0E+LIWAHxPUA71E1LFY^A@EF0E |$ D$$L-HLD辪L*IWAUAL 1ɺC1H5 gfIWHHPA7E1E1U1LjzoH ANfDEHHHEfDEH^HwHE|fDIWHH놅L-HLEIWHHYDAVI։ʹVAUAATUSHHdH%(H$1HHH4$H1T$HLt$xiL1ɺkH@IHHHUHAD$ DBD$@BD$@BT$@|$HtWHMHHLHŋD$@ttLH@kH$dH3 %(%H[]A\A]A^HHE11Il$E1LDPHATjmH ŋD$@uHHBxL H5g  LHHB1H 5 L yH5  LHAj@LH-jLf1ɺuH5 1w ff.fAVIAUIATIUSHHYC@Lc8thHHLLSŃ@Lѭ1ɺ1H5B  K@HC8[]A\A]A^fIHB11P uDI$>uS@Lc8;HHLLŃtg1L&1H5 > K@WIHB CL1ɺH5V HHLL#ŃyfDHHLLŃHPHLLŃHHLLŃ`HXHLLŃ@kIHB11wAWAVIιVAUIATIUHSHH^LD$H|$ Ht$hS LK LD$dH%(H$1HCHL$ ƒ@1T$h$pHLdHHQ@HXC@ =Lp H5 1E1/ HEHLfH$dH3%(D)H[]A\A]A^A_AL11H5'  f.K DL$LHDD$LeAnDC t$T$=L `C @=tmL yL1ɺ1H5j E1 Ht$LMILAfD$T$tLHutIHLL&AxH uxHt$HLh(AAIHLLA$…tLttL-aLUf…tH PptH }]H NQ@I1ɺ ff.fATIUpSH&LH߃[]A\fATIUSHtH߾pLH߃[]A\lff.RfBfAV1ҾAUE1ATUSHHdH%(H$1ȿ1ҾHHvHkHIDHl$0Hj VH;ILHHD$pMtH=$PL}D$p1A@lj|$@DB1@BIHXELHHDŽ$LHL1j$0D$tPD$xPD$|P$P$PD$L$H$HH$PQOH@HHH$HLHPBH$H;<HXBHoLHBHpo$HPB`BoL$pBoT$ BH$dH3%(fH[]A\A]A^AL5UY LLD$@D$p\1ҾaHAŅMtH=*NLuD$p1@L H5\ L~vH1|L1ɺH5 L9Å1L 11ۺH5 zDML 11۹H5 GH1AVL ML H5q XZ6Lѣ1ɺ1H5B  fL 1H5 Lt H5 fLI1ɺ1H5 _dDSHdH%(HD$1HPBt}1IHft:HPBH4$tyHL$dH3 %(H[DL1ɿH5 fL H5 L| H5 ^[f.DHIHfHIHfSfD11[f.AWIAVAUL- ATUHH5F SHIWDuLDE1AEHIHHË494tU_t@A_tjEHLtkHD[]A\A]A^A_fA_IDDuA_HIkfDuHTfE1EA@DuAH.@E1uAWAVAUIATUSHL6H|$Ht$(dH%(H$1ILt$ D$<HT$L9HD$@HD$0@MeLd$M9#InM1DIwHtM?M9uI$D$8HL|$!D$8HIL9t`I~IHIl$HuIT$H|$H3tI|$Ht$0@;LIwHL9u|$8~^MN1L2 H5 QLR 1H5l -H|$ wD$<HL$HT$(HHL$ IH9t9HD$L1ɺH5 9@H$dH3%(D$HD$0HD$PHD$HM/L|$M9tHEHMLHH$LHpH<$HD$M/L|$M9uHD$@H@L$<D$<LML 11 H5 GL|$( I?u0HHnHuI?H@3HCHMH|$HtHl$HEH9l$ @H$dH3%(H[]A\A]A^A_HuH|$H袈D$<"M>L|$M/M9H\$Ld$0I@LtsH}LucHMO1ɺt$8Ly H5b (XHZ~tH|$HsHD$(IwH81HE<IELMM9qI]DH6AWIAVIAUMATIUSHHl$@HD$HEt A@tfMtLL1ML 1H5y : /7E1H[]A\A]A^A_@tFMtLL{ML 11H5 EtFMtLL0ML 11H5 EtFMtLLML 11H5x 6E1ELL 1H5) H1[]A\A]A^A_fM1H5 LK 5-7CH[]A\A]A^A_L1 1H5 -7BDML H5R 1IHH5 H  H& MtIPM1L VH5 QRH f H MtIHMPL1H5 XXZ)@,7L +MLH H 1 Hf.AWAVAUMATIUHSH(H|$H4$HtHMtIED$A,MD\$HI $AtTEHDEwHtDHtH@HtCH4$H|$ЅuMtDHI EAuD$H([]A\A]A^A_H<$yAH DHc H>H@H@H$H@H@H%|H@@Mn*H<$JH$H@XHD$H$1H$H@XHD$H%H$@^H$H@XHD$H-H$H@XHD$HH$H@XHD$HH$H@XHD$H?H$H@XHD$H1H$@\|H@H@ eH@H@HQH@H@H=H@H@&HH@Hp H@H@HH@H=\Hp(H@H=NZ Hp(HHAxLH<$>6H<$( M \$0\$!DAWAVAUMATIUHSH(H|$H4$HtHMtIED$A(MtDHI E\$A#tTEHDEwHtDHtH@HtGH4$H|$ЅtMtDHI $A#uD$H([]A\A]A^A_A"H  DHcH>H<$ٱH<$H<$H<$1uH<$hgH<$zYH<$ KH<$莳=H<$/H<$"u!H<$iH$@[H$@ZH$H@XHD$HH$@[HMz@H$H@XHD$HH$|H$H@XHD$HcH$H@XHD$HJH$H@XHD$H21H$H@XHD$H3H$H@XHD$H H$H@XHD$H6H$H@PH@`H H$H@XHD$H&H$H@XHD$H'H$H@XHD$H.H$H@XHD$H/jH$H@XHD$HQH$H@XHD$H8H$H@XHD$H"H$H@XHD$H!H$H@XHD$HM\$AWAVA@AUIATIU1S1H#tNHtIsEHcLHA)L1HIcL A9~ Ń#uAE?H[]A\A]A^A_fDHG(H@AWH'IIAVEAUATUSHH(Hi0Li(H<$HHDA>ADDD$HT$H<$ L\$H=gGHDT$AAEEH1MUL H5 AYAZCA[L\$DT$ fDE1E1tvAEtfHs H;st\H<$DT$L\$ HsH<$HD$ HL$LH=X H1>8L\$DT$H5 xAZA[1L^ ?H5 PEt!L 1ɺM1H5i *CC@xH([]A\A]A^A_Ð:E1EE1t$E EEfDEtDD D tEuEtC@%{@yC@mA?cHn1MUL 1ɿH5 JXZ3M<1LH5X @MLv1E1AH5 1ML H5 CL\$DT$m1MeL H5 yC^C@f1MiLr H5x 9Cf.E1A%1ML3 1ɺ'H5* DT$L$ACL$DT$ DT$HM1L\$LE1UH5 AM1L H5 H,$^AXCAYL\$DT$HL} M1UA1H5Q _AXECY1ML$ 1ɺ1H5 DT$L$DT$CL$EH11DUH5 ML Y1^HLH= 3HT$1HLH= DD$3L\$DT$ 11H5 Ln1ɺ1H5 L 1H5 ^vfUHH=E SHHt]1HH/HHHuH}HH[]fIٹ1L H5 H1[]AWfMAVLAUATIUHSHHhH|$LHt$dH%(HD$X1)D$0)D$ )D$@HT$0![t]HHT$ L1A׉Ń E1MtID$HtDhHL$XdH3 %( Hh[]A\A]A^A_fHI9tAŽLt$tDLHHt$H|$AAMtID$Ht@DEAt!L1ɺY1H5 D9HALH9\$7lJtLA1ɺT1H5 RD11L NH5f 'NE1PAWAVAULATIUSHHH<$I9IE1pLHH<$AAMtID$Ht@DEAt+Lf1ɺu1H5 DL$ wDL$ HD9ALL9tKNItL#1ɺp1H5x 4H[]A\A]A^A_E1MtID$HtDpHUHSH/HHHt%H1HXHHtXHH[]fDHXHHuIٹ1Lj H5 yL11ɺ1H5 GDHtGHFHFHFBPF LF(HHF0U1HSHHHLHxD$t)L 1H5 [eL7 1H5q 2AŅLL@HIHL` AWI1H52 XZB@HsHCPHXL IH5 1E1VfHCP1LD$LH{D$HwH L~ I덐HL 1ɺI#fHHHH55 UIL 1Y^AUATIUSHHHFX uc@@u LKH1H5 Lb 1sHHL[]A\A]).fHH5 IHtGIL 11H5X HEPLEHHALLHV&HCXCDH[]A\A]DH HHwHCXff.AUATIUSHHF[t.Ht$HDHhHHEX@HŅtR6uH[]A\A]C[tHtHtHLA1Lq1ɺTH5& H[]A\A]f.HL:UHEHI:H61PIL H5 @H11AUrXZff.AVAUAATIUHSH:H]H9tgL5pf.HH9tL:uWH{֑tHsLFuM1ɺtH5 E1HH9uW:[D]A\A]A^Lp1ɺn1H5 E1fUHSHHKt".Huk}HuZKHu!D5tpEH[]DHߺKfEH[]1LJ H5 H1[].HC{}H.f1ҾH跒OQDAWIAVIAUMATIULSHHHFA[H1A]H5N4 ŅU1A[HA]H514 HYAE]H<I^H߽AH[]A\A]A^A_fHuWHD$@$HELm1ɺ1H5N D1H߾YL 8L H5 ҃HD$@H LD11\Lym1ɺ1H5 11Ҿ$HE藱LJ 1ɺIH5 1CfD1ҾHLHAE:ŅtbAuHL 1ɺIH5# 1$D\H[uG1Ҿ]HILyl1ɺ1H5 f.LQ 11H5 ZDAWMAVMAUIATIzUHSHH1ҾzHAEA1ҾHEt1ҾH;HUAEMAAIT$HHHHH HH H HHH HуH ugubttUEI\$(P01L IH5k @11Ƀ&EHDeAtFEABu A9r`t\FuUH[]A\A]A^A_ÐEt/1LM H5Ծ @11EfDHL I1H5 QH1[]A\A]A^A_þHHID$HtAEAtKuDAEf.1L BH5 1DAEfDh1jL H5 uZY1H[]A\A]A^A_f@HL*EIf.1ҾHAEA1ҾH葇Hߍ4uI-1ML߽ H5 @11DeAWIAVMAUMATIUSHHHT$tU1ҾH HApŅA7HL 1ɺmIH5h 1'1ҾHHL$1H߾1ҾHA$A<$Iu*Ht%H=i[ H@@@QLs@H@I92E1InHtZvdIHMtL`H1ҾHHH~HLHT~eŅMM6I9uMLxoHHH8t%H5H7nIHHIGL;I߽fI\$LdIHuM}&DLyf1ɺj1H5κ H[]A\A]A^A_fDE1M}۹R1E1L, H5 CL f11xH5a "M}Le1ɺ1H5: 1Hc@Le1ɺ1H5 1MLye1ɺH5й 1ME1@LIe1ɺL9e1ɺ1H5 E11JuDAWAVIAUATUSH8F4H|$D$F5HT$D$HtHD$HX@Lh@L9)E1DHkHWtXaIH*MtL`H1Ҿ*HHHƵHLHTbMHL9uMLlIHfHD$ H=M}HpD$(MIF81HD$ I/H5H99IG Ht DEL L> 11ۺUH5 MLaMuGH8[]A\A]A^A_fDLac1ɺ1H5 M1rMtDLDHo'aHHuDH@AVH9tAFMM MDLb1ɺ1H56 1LLb1ɺH5 H5HIG HDEH@AV H9SAF GE1E11H|$?H|$1L,HD$Ht(M]L #H5H)t4IG H.8$H@AVH9AFH5 HIG H0H@AVH9NAFBfDL9a1ɺH1H5 O(H|$1Ҿ8D$DAF5H|$1Ҿl8D$DAF4L`1ɺ1H5 M̿E11E1GL L H5FHþtBIG HttL FM1H@AVH9%AFH5HntIG HttL :H5"H@t+IG Ht`8u[H@AV$H9AF$H5HtCIG Ht.8u)H@AV(H9{AF(oL L H5H謽t+IG Ht`8u[H@AV,H9%AF,H5HntCIG Ht.8u)H@AVH9AFL 8L fH54Ht+IG Hte8u`H@AV0H9AF0H5HڼtHIG Ht38u.H@AV4H9RHAF4BL L ]yH5eHD$,t0IG Htl8ugH@AV5H9HAF5H5H8t|$(tCIG Ht.8u)H@AV H9AF L L n\$,L ^L8 RH5α 1M芼H5DH覻t0|$(tzIG Hte8u`H@AH9AH5Hctj|$(tSIG Ht>8u9H@AVH9AFL D \$,L C2L \$,L H5Ht;|$(IG Htq8ulH@AV6H9SHAF6CH5 H蘺to|$(tXIG HtC8u>H@AV7H9 HAF7L J<\$,L :bL  \$,L FH5GHt?|$(IG H8HpH|$ 胿D$,tHoH5HĹD$,tRIL 111H5 h/L,[1ɺ+H5 M?~\$,I5LH L q.\$,L aTAWHAVH@IAUATUSHH|$HT$dH%(H$1HW@HD$H$H9t+H$HXHuiH$HH$H;D$uAVHuIVI9H$dH3%(H[]A\A]A^A_1ҾHIHtE1LIc;H9iLH\$0L|$p1fLD$(LHH5i H)D$0)D$@)D$P)D$`)D$p)$)$)$ԫ HH=l$(HH=# HH=5HH=H=vHAH=jHH=`L HAFH@z1IV(H5vLժANH ODHT$,H5vLD$,褪D$,=<=9HD$A(fDLH5LV-I>dANH@IVH5QL%I~daANHf.LW1ɺk1H5 诶Iٹ1LOg H5ǫ 舶1LOW1ɺH5 g1IVH5L}L W1ɺ1H5b #ofDLV1ɺq1H56 CfLV1ɺw1H5 ϵf.IVH5 LݨANHTf.ANH@fDLIV1ɺy1H5 _f.LV1ɺ1H5n /{f.HD$H=I HAFH 1IV,H5sL,LU1ɺ1H5 訴LiU1ɺ1H5 f.H=H HH=˂HI~8IL 1H5A uDIV H5ALLT1ɺ1H5 軳fD1ILc H5Ȩ 艳1"fLIT1ɺ1H5 _f.ANHfDL H5X fLS1ɺ1H5. ;L H5 Ȳ;IV0H5qLANHWANH@MIV4H5qL谥ANI'11ɿL H5 L1H=ӻ HpHLEIvHL觀?DH0I9D$uDd$A9 H|$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$pHD$  L|$PI_(5 E1D$=HHH,HPHHH,H`HHH,Ht A$-H$L$LHHH,H4HHH-HDIIII,HtA$-dHHL,MtA$-nHHH-tA$- rfI_(AD;5+ IcIIIA$ -I$,E11LM1ɺ H5G| L胆IHGXL[If.IGH|$1HI[M?I95|KM?I9ff.EIhZG@[0IPDL$`EIGH|$HHpHXI菠I1M麥 L, H5{ @11ͅM?I9q@L;A@I輯IkIIGH@XHH|2fD$HD$@1LHYD$_fHL$hHL U H5z DIP1ATqɄH Dd$dEtCH$Hx> L% IH5y 1臄DŽ$@H$HH$H;D$8Lt$P11dHD$(DP EtD$E= HD$@@,t$ D\$`EL|$HI/L9D$Ll$@H}1Hu1z MLĔ H5x 諃AAYAZDLH58H=DHmL9uD$1111VH|$x'f.Ht$(L#fDHt$E11LFfHt$E11LnqHt$H$L$LfDL$Ht$H$LfDLi#1ɺ H5w 聂<@D$ELt$XfA@LA$-A)LA)FA)F A)F0"H|$踜H1AVI1H5Dw L ^_D$D$EHD$XfA@LA$-)H)@)@ )@0H|$,H1ɺ t$`I1H5v L" pI,AYAZH A$-D$bH$HD$XfE1H\$H$DM))@)@ )@01Ld$htX!HtIsA@LH1HcA)H|$XHIcL, $zA9~ÃuDLd$hH\$Ƅ$H$A$ -D$HD$ L5Z HtLpH|$Ӛt$X1ɺ AVI1Lʏ H5Xu AZA[bH$HH\$Xf)H)C)C )C0A$ -H|$D$QH1ɺ SIH5t L 1Y^D$ fH$HLt$XfA)LA)FA)F A)F0苏E$ -H|$EuH1ɺ AVIL 1H5@t H_AXH+- A$-D$PH$A$ -L55Y HD$ HtLpH|$*H1ɺ AVIL 1H5s p~XHZHL,M/ A$-D$D$\H$H$HsHtL$dHT$(H|$PЅHsHLNH1ɺ' HD$HLsu H5s 1}A\A]H$Lt$(H|$PHpLH$H|$xt"IFHthD$$$9LÉ$dL-1ɺ- 1H5r C}H5ڸH=^D$EL1ɺ4 1H5;r Lt$P|zf)HD$ D|$dERH$HxM L4 I @Li1ɺ 1H5q |DŽ$H5H=11c11:H|$xDŽ$HD$(H@Ht $H$($($($($($(|H0$H$dH3 %(H[]A\A]A^A_1HcH[HHD$hHh(H^H`(~Ht$H|$PE11芄H$H@HD$ AL$Ld$hHcHIHIA$a(I$h(HuEZH52q H=bkHtLpH|$]H1ɺ IAVL .Ly1ɺn H5o z$@H|$lj赣HBH|$HXH1ɺb SIL H5vo 15zA]A^g@Dt$dED$$苔H 1t$`I1L H5o yXZHKH1ɺ It$`L҉ DLa1ɺ 1H5n Lt$PryHL$L1ɺ H5in /yH|$谓H1ɺ_ ISL* D1L&HD$(H L1ɺ{ H5n xH5]H=+11踅11菅DŽ$?H|$H1ɺ t$`I1Lˇ H5m RxA^XD$Lޅ H5Zm D$xDŽ$DŽ$H=Qx4DHD$@HHw4HH$L+H9 H$0Lt$Hl$HHD$0ifHCHt$0H@HxH蚄uLsDD$`IFL`HEu}|$L5w4L%Mw4IELL;,$IƄ$0HC@Ht$0HxH nL1ɺA H5)l vJL}L9uu@M?L9eI?-uHLnuLHxHLHCH5w4H@H@HH~v4Lt$(HT$@H %v4H|$LxAvtIFHHCH1ɺ[ L H5ak H@LHHHD$H1 vXZH5u4Lt$(H|$H$LH|$xt$IFHtDxED$$$9LÉ$twLp1ɺa 1H5j uH5H=D$EL)1ɺh 1H5~j Lt$:uDH5bk H=HHNuDŽ$Dd$`EvDŽ$L1ɺG 1H5i Lt$t?Lt$11赁kH5q4H=t4]H|$@)ul$`uDŽ$DŽ$\$`=D$]D$gkD$lLsVIGL) 1ɿ H5i pHHD$PL1s_AXAWAAVMAUIATIUSHHH$DL$xH$HD$(H$HD$`H$HD$hdH%(H$1HC @D$ H$HHD$H$HH$H$HHD$H$HHD$H$HHD$8HC @L KHDŽ$0AH{IuzPLZ IH8@/H'hIH; H$0LHȎL1ɺhIHL% MM|$ 1HvHHtG/HgHt5H1HiHHzMHL iIM9\ A4$fDLl H5f 1Agq1L.1ɺEH5f FqHD$(HD$@H|$($($($($($($(}H0DH$dH3 %(1Hĸ[]A\A]A^A_ÐMH{L諧H{H4$H{C#MLbLIbH{M|L趤IHJHM1LH L0w(H{Ht$LCHD$(HD$@H HD$@DXEt HxS H|$tH<$D$ H5H]rAH 1ɺzH5d 1Lh oHt$11H:b L<$LD$|H<$tH|$H<$L$xʁDщT$xE Ht$H|$8H$0T{HDŽ$DŽ$DŽ${L$L;|$8D$0%H$`HD$H$HD$ H$HD$PH$HD$pfMwIoDŽ$DŽ$Ƅ$`MtHt$@L[Ht$H.{ 1 H|$ L$L;l$Lt$HGDH`HLHHD$X]^uLLD$XL)I9 MmL;l$nMe/LecIHuHLduH|$ MLt$H,MIH<HED$1HLd H5pb P13mAYAZ1LD$P1HHKHLHHH$PL$D$$^Y^HIH$HPH$PD$LD$H$$q_AXH$t7H 1ɺHHWTH$~$ $uzt$hLE1Lt$hHLL$PHT$0AXZAH=~H5;b (H/1ɺHHSfDL`~LD$P1HHyH11xM?L;|$8$X$X$X$X$X$XwH0D$|Dd$0D9DMH|$( Ht$@HEAGAIDDd$HHD$0H$0HD$@@HT$@HHX8/I|/H`IH$0H{L舡H{H4$HX=H{LdH{Ht$H3=1 IL;l$0 DŽ$0Im}@HLeLdH{LH{Ht$H IIf@L 1ɺH5[> !II@L6H$q fDH$H|$MifH;OH?L9uIF @IW_LH[ 1ɺIH5= 1sHIG11HIHCH{HHLHD$LHD$IGH$9HL$Ht$H$ H$hHo$Hof$XHL$`HT$(LHt$ HD$hЃE褱|H$fDIGLH$H$ HL`H$hHD$ f@h@xj@LL耢L1ɺH5C< G@L1ɺH5< F@LP4H|$@olfLL5H(]AED$pD$pLX H5; ^FD$pL1ɺo1H5n; /FD$pH$Cf.LX 1H5+; ED$pH$L1ɺH5: E@H0\D$p11R11nRH|$`$$$$$$QH0f.L1ɺDD$pH$h$h$h$h$h$hlQH0L1ɺ$LLE>;AAWAVIAUATIUSHH|$H|$ H$HL$dH%(H$1P,QI~hH޺@Ƅ$IIIH$H9E1Ll$PLt$DH{LHP跭HSLHt$H|$HD$AMtID$Ht@DEH59 At(H58 1ɺL1L3YCH5~DH=sD9AL11CPHH;$D$PH{@L(L1ɺ@H5#8 B@L1ɺF1H57 BH5N~H=ґt$Ht$Ht$Ht$Ht$Ht$HOH0H$dH3 %(H[]A\A]A^A_fDDMtID$HtHf1ɿL8H5K7 BIIHN1ɽ9ff.UHSHHAt"1HHt*H[]ÐHAfiL41ɿH56 QAH[]ATUHSHx@H߉Eh@1Ҿ3H߉EfO]3HߺRCHHE@j@1ҾHEX`HC@t`HNAą*HN1ҾH߉E RL T 1ҾHA_RLT HE0L9Y1ҾHrRLT 01ҾH RHHE8L9H}0HHt-HHt HHtH1HH91ҾEHQLhT 1ҾHQ1ҾEHpQHEPH`HMEHHH߾A,Q[HD]A\D1ҾCHIMEX!LS H53 1E1>D[]A\f.1E1ALQ uH53 s>D[]A\MXLQ 1H5x3 9>LR Rf.HZHu8HHu0IZH1ATI1LlR H5 3 =XZHE0HE8@1ҾH1HHEPHO-HHEP?f1ҾHEHCfAWfIAVAUATMUHSHHdH%(H$1HG )$)$Ƅ$@D$H$HHD$(觵H$HHD$@蒵H$HHD$}H$HHD$ hE_L}E1M8@H{LlsIFHLLM.A9oIA11J<KIH{XN$sIHuL 1H5?1 @H5 1LB Ih1Z)It$Dl$0I|$@L#" 1ɺmIH5^ 1)AD$TI|$?LkB IH5! 1(H|$LSL6AT$TufDHxuEifDHAPL1H5 T(YL> ^1ɺH5r 11(4L1ɺ1H5J  (H计H|$@HE1vE_Et_H\$Lt$@IH$DL$L9u-f.HL9tH{LuHH AE9owH\$IHD$A0MIHML%@ ImL9l$M(FHEIIH;l$HMNM1ɺeH5+ 1IP&AGIVE1IvAVHPEO-AYAZuH|$L.yH|$HLe11NH5 {&VH|$HL211H5 H&#L&~MImMM9u!fDHEIIL9HI}٩tI} 1ɺIH5 1%H|$(L+L|$PH54HD$0H\$PL|$XH|$^|$HSL"1ɺK1H5w 8%;L1ɺL1ɺH{Ht$HHT$h[HT$hDL$0HB0EL1ɺH5 $D$LN 1ɺ+H5 $D$H|$u |$HA0M(M{L= 1ɺy1H5` !$I(HHD$@HMIEMHD$H$HD$PL9l$HLICTI}(WIH%HD$@HHH9t+H}HCH;G@usH}H9G@dHmH9uLK1H5 L A#H|$L贜Ld$I$LL;d$tWHD$GHI蘝L 1ɺO1H5! "L1ɺmOLIH$HD$0LmIH9l$L|$L}L 11H5 Mo"HD$HuHHP(IHHT$0oE11H) oP)RHuȋL`H1ɿPL}1MH51 !_I|$@AXjHD$p t=1ɺH5 1ML !I|$@1r1ɺH5 1ML; u!1LH8[1MH5} L; @11Ƀ1!Ht$@HD$LfHIEMLL;l$IHD$0tETuH|$葚u |$HH{(UHD$@HL H5 H|$LkML: H5 ] H|$LЙ4M1LMH5c $ H|$L藙ML9 L|$MMI.MM9u_fIvHĔMn軅1Lr: MH5 @11HEIIL9tEHI~uMNL9 H5 LH|$L还L$L%9 ImL;l$(HLIXI};IuLMm1MMH5 @11HEHIH;l$(tEHI}3uMML79 H5 H|$HLHH$Ld$ H;l$ tH}芺HmL9uIL% Ll$H9l$t6HC(Hu1ɺMLH58 1HmZYL9uH|$藗D$D$L6 1H5 Ls1ɺL`1ɺ 1H5 v L 1ɺ91H5 PSL1ɺ>H5f ,/ML| )1L IH5& 1HEILIF螕IFHT$P1E1Lo)o`)bHs)d$0?fLc1ɺq L 1H5 cH|$L֕L1ɺ1H5o 03M(L$ |H5C :f.AWAVAUATIUHSHHLiW_HL{ ILCHH?MuL HImHHHpX1MUL8 H57 @11Ƀ.H[]A\A]A^A_f. HHHHD$L1L!LT$MuMCLLLT$A &LH7 ,H57 LT$L LC1ɺAHGLG7 udH苔uGH蚨HL1ɺRH5w6 L17 K1H5M6 H[]A\A]A^A_Ly1ɺD1H56 H[]A\A]A^A_L5 1 H55 TL5 1H55 $M&1L5 H5r5 LT$L eff.@AUIATA1USHHdH%(HD$1H$rHHHHEyHDE1HuE11LPHUjwH H<$Aa 1yHHtHL$dH3 %(Du8H[]A\A]ÐLAt 1aH5m4 Af.DAWAVAUATI USHXHt$dH%(H$H1@HHILHHJ1H;Hl$@ HL$0L|$8Ll$HL$Lt$(fDCHúHHs &QHL$11MLHl$(hLl$(LL0uHAM1t$8L4 H5y4 HD$ XCZpLl$A*D$LU11'H574 kDL$LDL$DL$H$HdH3 %(DHX[]A\A]A^A_L1ɺ,1H53 E1f.L1ɺ#1H53 E1s1ɺ9D$LyH5d3 Ll$DL$(fD1ɺ>D$LAH5,3 Ll$`DL$fDL3 1ɺ01H52 /A_ ff.@ATUSHHdH %(HL$1D$ftrHUtaHDLM3 lH5V2 1AHL$dH3 %(D8H[]A\fL2 1YH52 A6@H1H0.HHhxHEHFHt$H=DL$EH5"HA01ɺHHHHpH訞`H(H߅H7,HA0DHHHoy1I麚L1 H50 @11H+1ɺHHA0 1AjDH@+H<HHaf.H11rUL31 H5/ X1ZH5/ 1sLD1 HjT$HH=d1 \H5*  L11L, 8H5* c sff.SH 9CPtH߉,ÅtD[1"Lc, 'IH5* 1 [@1L1ɺ,H5)  [ff.AUATIHUHSH8dH%(HD$(1<oUho]xH]hH)$)\$ AŅHHH9t#HPooKJHH9uHHLA؍Ht$(dH34%(DuuH8[]A\A]f.1E1LZ+ H5( LLZ+ 1H5( xff.U1HSHHtH9wR1ҾH;H5"ÅtgHG|ÅH[]H߻$L* 1ɺzIH5' 1H[]fD1L1ɺH5' H[]fDH߉ƻ$H1PL1Lu* H5~' LXZH[]ÐLLz* 1H5G' S1HH߻m(t [DL11ɺoH5& [fS1H<H߻&t [DLG11ɺdH5& ][fAW:AVAUATIUSH1H 1Ҿ7LH HtuHtpLYHL€uHƹH=ALMu9H`wL-ȘLLMtHtHLLtH8H8AŅHH=RHHdu-LXHHC`L7HC`HHLu?L1ɺ1H5$ H[]A\A]A^A_f.HLH XHHc`HHHǃH9tHPHHǂH9uHLHHD$I9tGMwLt,HH=AuHIM?L;|$uL=fHLuK,DHHLHǃ HLuOHL=H;l$t,f.LmLtMHmH;l$uހc,f.H8H(HHt&H=uID$(xz~Hh1Li' IH5" @11ɃH[]A\A]A^A_@HtH=UHI1L& H5h" 6bHHHc`LHǃH9HPHHǂH9u@L1ɺDHC`@H1H5! IAUuL% Y^YfLL% 1H5w! EqL-TLDH1{ULL$ H5%! XIZL$ }1H5! f.HC`LIL$ H5 fDI$HǃHt H{HL7H0H`L1jkH`La IH5: 1Sff.ATUH1S HHX HtntgL%$ ,fDH{?t_HutzH[Ht9t2tL^$ 1CH5 iH[Hu[1]A\fMH1H5b 0fD[]A\ff.AV8AUATUHSHHLadH%(HD$1l1H߾7HD$Iҿu.HT$dH3%(H[]A\A]A^HLMtzH=Lu`LHEmLH-uLLLs# 1ɺpH5% @fLH 1HL$HH蛍D$tA$HH=6uAL$1LI1ɺqH5 a9HHH萓zL1ɺtH56 VA$HH=#AL$fDL11ɺkL! H5 fAU~ATIUSH1HPLH7HLHHL_}I$uUHtpHdtd1H5/ 1L! Lr}t!I$HH LU11ɺ(AULLu# H5 HHXZ08Hp(HLa1L IH5Z @11Ƀ"H[]A\A]fHX.I$HH1H5  IPL! 1Y^L1ɿ1H5 L! LH1HH=! Dtt oDAA|$MII9tHsLHL9uL+Å"II9ufHmL9H}芸tH}G[@uܾuΉD$ HMLP SH5 lA\A] AF`%AMLnL)>D$ q`II9qD$D$D$f_+H]H觷uA@HHuCYuoHucHCXuXuQ@uJLDH߉Pu,AZDHLD$D$fHmI93_DL$EtG|$AD$L L| H5  PHN LD11_AXt$t |$ZI>2L$LI'Z1AمLe H5 @H11UYXZHL$(dH3 %(D$ H8[]A\A]A^A_H8@[yH&HifDH9CHPJ3HHCXA@L1ɺ\1H5 L`1ɺ 1H5 vD$ fLL1ɿLH5[ .I>ufML 1H5' YHAA1L H5 1[]*XD$ XHL$$LLrD$ WHDL HL H5 HD1ɺP1ADL$4?AZA[fDM1ɺ1L H5: D$ HL}CXLg 1H5 D$ ND+\I>ffDLI1ɺH5 aD$$ff.@AW}AVAUIATUHSHdH%(HD$11RH0E1L sHetLHAHL9uEtVLeL襥IV1L( IH5 @11WHtV1ҾHLHjJHL$dH3 %(DH[]A\A]A^A_f.eHsKH^tLD$ #=YH5{LHhLS1ɺH5 kDHYCL 1ɺH5N !M1ɿ1H5! Lg LH}L1ɺH5 L1ɺfDLi1ɺ1H5 XSSHL$LHH5)ASMDt$H~HD#T1ESL7 H50 AW@11ɃXZE9L1ɺFL1ɺ3AWIAVAUAATUSHH++AHHA_H^ HHt&eHL  -HuMHXt6KHG1ҾH@YHt&}HL nHt)1ҾHL 4Ht)1ҾH]L HfEuAD tEtH+tt ȀHtHC(@w[~RA1HjEIHHHD1PHEE1ATLjHJH LH߉GH[]A\A]A^A_fDDHcfD}HCfDH%H HHH HHD LS H5 1@HK;DH6&_H! H1 @KHYHeHE1AYH\xfD1ҾH z@HKH= 3%L( HD[]A\A]f1Lz> H5^ A&HD[]A\A]SHH`tHmu;[ZL1ɿH5t [Hhm^L| AH5; 1f.ATIHUHStfHHVÅt HLH[]A\Ð1L 4H5 []A\DL 1'H5 []A\ATIUSH6u2HHE1PjjLHE11?H []A\@HAHH HPjjAWAVAUATUSHdH%(H$1L$HILL2^LH語I1H߉$Hl$PH$ L$rzIHHLt$PL4\LHaXIH5rH HT$8H5VHyHH4$1ɺH@H4j<H<$1VH1H9IHLHHt:HDbH4$H踎HHH@H@@YtHEHHHEXt$Ht$Ht$Ht$ HHt$0H st$(HG_ HLH{IH9D$t!L 1ɺ1H5 IH9D$t!L 1ɺ1H5 HtbLk@L{@M9tUMuLt01ҾLHVHH#SMmM9uHʶH HT$81HH`k H<$q=H4$1ɺHLL5 MLBAUL AVMH5 11Ƀ^XHZtHLH8fH$dH3 %(H[]A\A]A^A_fLL H5 H<$poH4$1ɺH0Lm|1ɺY1H5 NfL9|1ɺ>H5x QL |1ɺ@H5H !H<$pQH4$1ɺHL $1^L] H5 fLy{1ɺz1H5 H<$oH4$1ɺH[tWHLH6f.L $L ~QH5F Lz1ɺH5 HgHTLz1ɺ]H5 H&1LH6LPz1ɺiL=z1ɺXH5| UH1)u1L^5 cH5< Ly1ɺH5 Ly1ɺ]H5 Ly1ɺXH5 ZLcy1ɺo1H5 y H`HM`VLy1ɺ1H5[ /eLx1ɺH5- rLx1ɺH5  NL H5 )LL$8L H5 H諁HshLLx11H5 b1Ҿ7H>1ɺHHIgH5gH2MH5LZH5 LCEH1ɺpML PH5 1zXHZ0tLHtt@[51MuL H5 @11Ƀ1[]A\A]A^1Lo1ɺsH5c []A\A]A^ÐHx1LH=x /HX[]A\A]A^A_fDLD 1H5 $DHMHLmIfLj1ɿH50 NLj1ɿH5 HH&11LEjH5 df.L|% 1H5 ,]f.ATIHUHSHH/Hc`HHHH9tHHHHH9uHTtxH}tlHx.1L? 1IH5 @11ɃN[]A\@I$Ht H{HHQ1Lh1ɺ/H5 []A\DILT 1H5R []A\I LD f.ATIUSHu&HtHuHHugHHE11PALjHjO&H []A\fD1L AH5m []A\fL 1ɺQ1H5@ lH#!Lw <H5 iTf.DAWIAVAUAATUSHHdH%(H$1Lt$@Ld$`D$$H$H|$HH$PH|$HHD$0HHD$>L>H|WfL)D$`)D$p)$^>1H!H߉$ Ј$H5dH߃$ Ј$RHHc $E$AELMl:fDѼHLxHLH=L9HHuHiIHuLML H5 1dHGH$dH3 %( H[]A\A]A^A_Ðt'H_?>fL 1ɺ1H5{ $fHl$`L9t%fDHHU1HHPHmL9uLV 1ɺ+1H5 H-ytiLHHk^Ll$`M9uL@MmM9HIUHHHuI}ؔI}HHL UI;H5~ 1]A\oLc1ɺH5H CHl$`L9u#HعHmL9Hu1HCHHEHtH|$xHuH{H%HD$xHuLb1ɺXH5 fLH5u }L 1ɺH5Q $H}]LL IH|$xHl$`L9tfDH}]HmL9u1ҾHWv11L2 H5 H1*HHfDHHIHtzHD$`L9tL;hu L9htHL9u賸HLhHLk9L ZH5 1pHLg 11H5 >Hl$@L9t$DHHU1HHPHmL9uHLH[Ht$11HDHaHHH|$HsHH1wiHt$H|$1L= Ll$0L;l$uMmL;l$twI}Ht$藶uHL$H|$LA辀yL AUULL$(fDH|$xL `VH{Ht$L_1ɺIH$HvL 1ɺ1H5) 荾Hl$@L9tH}ZHmL9u1ҾHos1ɺ1H5 L >1ɺHH$Ht$x1ɺHL1HYHE11HD$0H߁PH$LL$4sAZA[HHDL$$EHD$PHHD$S6H+t$1HOLLM9E1 M6M9I~F IFHp@HE1E111H tIFAHx@L HIH5o 1ѼLL$x1L H5? 証H|$xQf Ht$x1ɺHr& H$mQM H$1ɺH>L]1ɺH5 1 L\1ɺHL$xH|$1H(pHL$xH|$H 1CLL$xLp 'Lg\11H5 肻H LC\1ɺ/L0\1ɺ1H5 FL$LS IL4 LL$xL vLL$xLX H5g ƺ]LL$x1L6 H54 蘺H0H|$xOHt$x1ɺHZH$UOH$1ɺH&BD1L H5 1L4 H5w HxH|$xNHt$x1ɺH袡H$NH$1ɺHnHL?Z1ɺH5 R舰41LL H5 91LL H5 LY1ɺH5d ȸ_H;1ZLpY1ɺH5 舸!Hs1\E HL9HxL|$`HW@M9tI9Wu \@I;WtRM?M9uL$@LC2LX1ɺZ1H5 LHD$+1H|$L0HD$HL9_HD$`L9HxLOLM fIPH5 1ATgZLO Yg1H5 Ct$1H&t-1L_R1ɺH5 wL>R1ɺH5 VLR1ɺH5 5H訞tH1 H萞tQ1LQ1ɺH5x iLQ1ɺH5T 轰LQ1ɺH53 蜰f.AWfAVAUIATUHSHHHLaH<$dH%(HD$81)D$)D$ D$0H9u Hx@tHH9H{9HCtoHT$H1MLg H5M )\$o`1)d$(R(ǯXZHT$8dH3%(HH[]A\A]A^A_DL D$ M1Lt$I9tDIGH<$E1LoHHXHp@A)oPA)VM?A$|$ I9uYLֈtLd=L 1ɺQ1H5U @LoD$ ?f.AWAVAUIATA)USHHdH%(HD$1D$tH5aH߽ZH:Hh1HE1E)eH1HIHHD$HE11IFALDH$Hf@PAVj H ŃD$H$)DL$L 11H5 FLH HL$dH3 %(H[]A\A]A^A_fDLE 1H5` f.LU 1H50 輬EhH@2肝WDHA*&Lv H5 ` LH5 6L H5} fL1 1H5P ܫH訄L H5 螫fLYL1ɺ1H5 o襢DATIIL U1HSH5 12E111HLPHHt H0lu H[]A\@L1L H5 ժH?u)1ɺHL角t3H1ILt5H|f.LIK1ɺH5F aL(K1ɺH5% @ff.AWAVAUATUSHdH%(H$1H5IHD$(L賂H31LFD$(HD$HCHD$EHDHD$ HD$`HD$@@Ht$L#LLJ1ɺSIHYHt$LIHIXHtfI$XHtY9HFH kH5 IL/ 11ɺHL6LLL.pL`6tLT6LuI1ɺvH5w 1膨H|$|=RHt$1ɺLPLH|$F=fHt$1ɺL"L躺D$(9MHD$HD$\$(H;D$ 7HD$1LH0e^LHHD$+H|$HމD$, "L2H\$Ht$HHLIHHt$LIHH|$N<sHt$1ɺL"3L¹LG1ɺ^@H5 1L H5 ΦD$(fDH$dH3%(D$(Hĸ[]A\A]A^A_LL$L GH5S dE1ɿLGqH5 4H|$*;L蚓2LDLF1ɺH5 @LPL}LF1ɺH5~ 虥<@I$XHt:IXHt.L9IB!LLL*IIHD$0L;H9f.HLJHL=I~HkI$HEpHCI$Hx@蜻H LOUI1H5 谤HCLH@H L_M?AXH;D$0dI$I$IIHL$8HT$HH9Lt$XL|$HLd$PLd$@Ll$0IMuI9I @HmL9tyHELHX Hd/tH.`@LH/HEH1ɺH5 L LHHAT1詣HmY^L9uHD$0HMmL9l$8LLl$0Ld$PLt$XHT$HH9t*AoL$hAoD$x@HEHmL`P@H9uHl$8H\$H@IHHtLC1ɺLH5 LC1ɺH5 @LC1ɺH5~ 虢@HEL Ll$0Ld$PH5E LHH1Lt$XULC1ɺH5 Ll$0Ld$PLt$XLB1ɺmH5 LB1ɺZDLB1ɺ6H5 詡LrB1ɺyfDH|$6Ht$1ɺLZLL#B1ɺV7IEHp ID$Hx IEHx tIEHp0ID$Hx0zIEHx0tI$XAL$,1LA$AI$A$II$")1ɿ1L H5S nL&zLfUL6?II$21L IH5 @H11UXZqL@1ɺ]H5 ؟LKLpL@1ɺUH5| 藟0L tXLnLB@1ɺL/@1ɺH5, GIXI$XTL?1ɺUH5 L?1ɺ]H5 &$@UHeSHHVt H`u&HH;tJH[]fHHu˺LE?1ɿH5k bL?1ɿH5B 9H[]ff.ATIU1SHt5HHLPHAE1j1j*H []A\@L>1ɺ"H5 豝[]A\ATIUHSHH"4t&LHH;t []A\[]A\ff.AWLAVAUATIUSHXHdH%(HD$H1I9IL- HL9t5HC@[tLHHM1ɺ>H5 11軜HL9u˅AM$1L DH5z wL 1EH5[ SL 1GH57 /LP 11HH5 I$M$L9I HL9H{H@t T%ttA$=H{@LL'HA$11H5 M$L tHCY^H)1MA$L H55 -XZL;1ɺO1H5 1HL$HdH3 %(HX[]A\A]A^A_L;1ɺ"H5 LHA)$A)$@H{FfL 1H5d \,?舑AWAVAUIHATUHSHLqHt$%AuHLHHAFsHNH[]A\A]A^A_DA@LH"LM9u*fM$$M9I\$C[tH H@@C^ILۘt CYH[tH蹳1ɺxH5 IL< 11ɺHL3;L91ɺ{H5 ̘1L91ɺH5 諘LKHq1L H5 xM$$M9LHAFH r\LL$1L H5$ H[]A\A]A^A_AFH[]A\A]A^A_@H(Q L81ɺfH5 豗@HL8LY81ɺlH5t qff.AWAVAUIATUfSHH8dH%(HD$(1D$$HD$論AL AD tvIHstL EtGH=L uEtvL H5y 1jHL$(dH3 %(BH8[]A\A]A^A_DHÕL2 D tIu1H菰H5HHD$ CHn1HIHHD$IFEHD$H1E1HQA1HPAVjHL$(H T$$u+D$ DBLHf;1LL$L @H5 11 L hf.H9uE1HPIUAAVHL$6Y^VLy51ɺH5 茔{1LL$LE @H5T 11JDLq 1H5$ Mf.AVfAUIATUHSHH0dH%(HD$(1)$)D$HA=HXHtHHQ1HH_EuHdHt=H<'4HHA"HL$(dH3 %(DH0[]A\A]A^Af5z/1A1jHHLL$AXZA*L31ɺ?1H5 讒vfH#HAAƅEeH,1DH= LtcHkH61IمLk H5V @H11UXZL,1ɺH5 ًM@L\ 8H5 讋0@HsMAWL 1AVH5 nH DL),1ɺH5 A`@L,1ɺH5X @HxLL+1ɺH5 ъZHML 1t$1H5 蠊AXAYWtJL 1ɺ1H5 rL6+1ɺH5 NIL葽LHιQH5X Mt$L ^_D2fAVfAUATUSHPdH%(HD$H1)$HD$6I1HI4$%It$1HHHHHI"H{H^H$HH{LEHD$H'H5@HHwHbH|$ HDl$AEA Dt$uHLD ADl$1H IHHHAE1IFHH1P1HAVjH AD$u`LH+L H5 AXHL$HdH3 %(DHP[]A\A]A^@L(`1ɺLHovL(1ɺH5& RfALHAADt$]DLy(1ɺH5 A苇.fDLI(1ɺH5 A[fDL(1ɺH5p A+fDL'1ɺH5@ AfDL! 1H5 AƆiH8tt 1蝯Lq'1ɺH5 艆}fAUHATIUH- SHHHBH@Lh8L 1ID?AU1L ATI@H5 11XHZ7%H[]A\A]AUIATATUSHH_tS1ҾHIH߽ZH2H:H[]A\A]DHHHE11PE1DHjLj}H JH߉躄tLDH9LH[]A\A]fDL %H5 لH[]A\A]@1L/ 1ɺ3H5b 袄H[]A\A]DL )H5$ iH[]A\A]f.fAWIAVIAUATIUHSHH_Ht$HIM94$MLLAoGhAoOxL{PKMAEL1LA9]LvgH@IHЃ8uH@HtHL9u RfH?L9tHH;GuHt$LH"u1H[]A\A]A^A_DH[]A\A]A^A_@II9t@H;B^HI9u1f.LLEHL$HAWIAVIAUIATIUSHHjH蚸I$Hut5H|$L 7q3Lؙ 1pH5ܚ AD$ fo|$ fot${3FHH|$(HtiH|$Hf.ATf1USHH`dH%(HD$X1H)$HD$Ho L$@HBHH5@ HD$P1etLd$@HLauEHeCfHC CHL$XdH3 %(HuYH`[]A\@H|$ t$t$t$$$$H0HfoT$ fo\$0[ESHHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81H$HD$ HD$(HD$@HT$ HHD$8D$,0$$$/foD$ foL$0H HKHL$8dH3 %(u H[DAWfAAVH5Q Lk AUATUHSHdH%(H$1H|$jHL$b$@HL$ L$8)D$ H)\$L$(Hl)D$H)D$XHD$8HD$jHDŽ$HfDL$hMSHm3AWAV1ҾH BaHL$`H|$bLAźlH $[H $UM(1L=m3L H5+ ADE1:AŅ$E1E1E1HPH5Ŕ 1R#AE1H EI:H5:LT$H $ =LT$H=)3HAAEED\$I:1H5 L$L$D\$HfH?L$1H5[II:LT$aMLT$D\$$t0MZLLD\$LT$1@LT$D\$D$D\$LT$y$9nHi3RMGPLF 1H5 XZLT$D\$DD\$LT$7LT$D\$vE1D,$>Hri3L01fUSH\$ x4H-g31ɿ1AL H5 U>5uH|$(H[]8f.| H5} P1R9ADH *11Vq,'ff.HW 1HH!fDSH!1HHH[!ATIUSH_Hu+NfDHtH{!HH!Ht%A$Hk H{ul!f.ID$ [ID$]A\fAWAVAUATUSHEuH[]A\A]A^A_IDEIHI9YŅu+L P31ɺ1LH5| AL EMLHHLcxUrL H!%tLLDHJHDщHL)HF)$LiO3H1IAUL"} 1H5{ AXZDfu DM bfAUIATIUHSHt0"c5AEc5A$c5EH[]A\A]ÐL N311L<H5+{ AH[]A\A]ff.S1bt2-3t4H5b51Htغ[f.rb51t19[ff.SH#H{Pt]HtH{H{H{XH{`H{hHHH[}Ds릐HGPHtcHD@ a5Da5Ht:HIHAPLLQDH1}%Hf.HtHt'HHHFHHFIHFIHF HwHuH1HII1@SAHcLHHQH$ZY9[ff.f1HPfFF HOPQt}~׃~ ~~ V,Q~(V$QVQ HI(VHHVHH  ʉVDf.HGPHtM@tGx0L@0u LGMt2HDH$RT$0RSt$H$$$$$$$$Q$$ASPHF/$N 1WUAPLq ARAV$VH5f H$Ӌ=n3L1H$JAÅEA/H$AHH5 AI|$0 }A/AD$H\$1L8q FH5e AAE1tAG.A AAH=r HcH>H$H EG0EbH- L%+/HIL-Fc HHfHHHHH€tԹHL€tHL€tHLKOL 831ɿLRH5d AHGHoH$ ?HHXHtKHIHt;H8t21E1LAEAD܅tILIu Nu1HW|fA,'FfANH ?73Aw0AW4HL$LGL =tL .HH=-H,b L.L!b HL$H .MIEHSAQA1R#WVH5Bc ASUAPL.h QAMc7HPAugH$t\H$9tOuKID$(AOMH H HDHLPHRVH5L P1RGH 8HILJ9 MwAU1LGQ jPH5jL 1ALKH31AZ1A[kLK H5:L H3LM1LK lH5L 1pID$PLIGPID$PFkA4IA09I`Ht.E1LIR H@HA$8E1Huff.fAUIATUHSHHdH%(HD$81&HHMyLAH%C0LH % ЉC4ELPH5B 1AZA[L3MW1ASLG 1H5pB AAXAYYfATA US1HdH%(HD$1f|$D$xwHt$߉,L31EU SLH H5A AXZHL$dH3 %(H[]A\H3H(82AٹLG P ATH5eA 1Y1^D8HB3H( u"HAٹ ATLF fDAٹL$G P ATDU1ɉ1S11HGxCHL3A1S LG H5@ AXZH[]@H3H8*AH5l@ PLF 1 UY^1H[]fAWAVI1AUIH=kRATUSHdH%(HD$1Ld$ŅLHo|$ftߺM ADžf|$tHAL%3LG P H5}? 1A$1D1AYAZ11 DFP 1AWALG H5? A$XZyt L1ɺ 1H5> A$E>A]@8@ L%3I$NLF IH5> 1Ӊt L1ɺ 1H5Y> A$AE16L 931L+E H5 > AAE1HL$dH3 %(BH[]A\A]A^A_f.L%3LBE 1 H5= A$7L%3LJE 1 H5= A$E1fD\$zfL%i3LD 1 H5P= A$M4$8HEL> P H5 = 1A_DAX {@M4$8EH5< PLnB 1SAY^=fATUSH0 f2dH%(HD$(1x.H2xRHD$(dH3%(H0[]A\H1122yHHtuHHHAHAąL 3LD 1! H5; AHmH%{22fDH31ɺ 1L)H5; LD 1) H5r;  2L Q3 11LC H5;; A1HHx5D%2L 31ɺ7 1LdD H5: ATH(H311LF H5: fUSH=M tH HDHLXPHH5n7 P1RAH iWAAWAVAUATIUHSH(Ll$hT$L$DD$DL$LHHHD$:h5t L52H2M>I9 fDH|$HRHHhHPPD$LHHT$C D$C$D$C(D$C,D$`C0D$pC4D$xC8$CLD$CH$HT$LHSHPHcHH= 2HC@H5SHH=7 fH([]A\A]A^A_fIvL$IMI9IA~uѐ_L52H2M>I9IvLt'DIMI9IvLIjuLH=^6 LD5 5 5`L5 2H2M>I9uEDIMI91IIvLuLH=5 ?LI5 ;5 A5DLH=5 Lq@L 21L@ H5h4 AH(1[]A\A]A^A_fD1E$E$$$^ff.H 2HtH8H2H?HH H5zHH2H0ff.H 2HH9tH2H2H9H}2HtHHH_2H8H AH5HH@2H0ff.= 5DHH5V4 Mff.f 5L2? H52 DHH2D g 5L1Aff.@H2D > 5LEt6A"1D  5L0? H5m2 AfL> 1H5G2 Aff. 5D=22DUSHHHt}(H+HC@C|C,HC0HC8HCHǃHǃǃHǃHH[]DLY21AL*> <H551 AHH[]H1L 211LvBH50 A|ff.ATUSt[]A\IH52 H~HtL2H1MS1L= H50 AXZ[]A\ff.fAWAVAUATUSH(Ht$HT$DL$HIHD7HEHMID$HD$HE1D$1)fDM97G4AŅEHIELHAHH5|o t_L=2AH L kLEȹ1OMAUL: SH5, ALZYI$HHAHEHIٹWE1LF2L: H54, AL !21ɺB1LqH5 , ADMLn: E1QH5+ AkDIٹGL9 2f.AWAVAUATUSHH $HH $HD'dH%(H$!1IEuYLR2IL9 gH58+ AH$!dH3%(D.H![]A\A]A^A_Lt$ HHտL(AątiLHv A}/t/HLlM}L<, L2H5* 1E1APH$IH V2HD$HH=w 1zHt$H$kHD$HHD$H9$uHtzHsH{1HAH$MH 2HD$HH{+ 1c*Ht$LHD$HHD$fDH=y2IHH$@L5 HD$L$@LH7LhLLtչLH=t1MH 2LHu HT$LxHD$H9$heHl$LHLH2H(82L f21PH$LPH5Y( 1XZHl$>L72M1L) sH5( AfLH2IL) 1E1H5' DL2I1L4) rH5' Akf.MLV6 f.Hd28L# =C2H H HDHL &2PHJ#PLH5' 1RgAH ML( H-L#8胿1H5& L 2PH"PL1AY^ff.fAVEAUIATIUHSHdEMHHLHxiuHHHtH[]A\A]A^HHHuL !21L 5 H5& AH[]A\A]A^1H[]A\A]A^fAWAVAUATUSHHt$HL$dH%(H$1HHID'HEIHD$Ht$@DE1Ht$ Ht$Hv8I1L22Lj H5  A1[HHPH=͵2[ÐL 211ɺLiUH5 A1[fDH2@AWAVAUATUSL$HH $L9uHHt$IH5DH=) dH%(H$P1HcIH$pH$0HD$HD$LڧH9H¾LHD$茟LL\$H H!%tDHJHDщ@HL)I9"HILLH|$HELL\$L\$L詥LyLAktfDˣ8Hr2L0A?MH H HDHLPH0H5% P1RAE1H C@H2L E1+H5 IHD$1AL謞L褞LT$11LDM H5 AH|$Aȣ&M1ɺPH+0LPH5Q 1AAXAYLHT$VAefD1H2L0 H5  IHD$1AfME1L2L H5 AfDL\$EH2L H5 IHD$1AL\$LuHD$HI譡8A>RPHPH PMLNH5" 1AH :fDS8H2HD$L(蔞A>MH xH: HDHLPHH5 P1R7AH H2L\$HD$L(ɠ8"A>MH HȊ HDHL PHH56 P1R>AL\$8H M1ɺ9PHIL?PH5 1AAZA[ H2H8wA>tSWPH-PH PML|NH5 1H VPHPH3QPHPHff.AWAVAUATUSHH $HAHIIκdH%(H$1HىAL-2u$LI1ɺj1H5 AU$H11IAWL nH5 ATUAUAFH H$dH3%(uH[]A\A]A^A_qA90tÐA9PuIHLLHUSHH $HdH%(H$1=2u+1H$dH3 %(HĨ[]H$AA1H 2HV HExiHH޿џԝ8tHv2H(&I1PH~ L}PH5I 1X1ZBL 121ɺ 1L H5 ADH`ff.AWAVAUATUSHH $HH $HdH%(H$ 1A|$t$H=Ht$D$u$L o2LF1ɺ~H5[ ADL$AEt2H$ dH3%(DH []A\A]A^A_fDADH$HAŅtH$1H Ȧ2H Hd HėIHHD$ L5ɛ HD$L-L=y2fLȠHL@LLtչLLt1ILH HëSHT$H޿IqL8qH2L(蒘1IٺPPHy{ H5 PL{1AYE1^3L 21ɺ61L H5 E1A@fE1Le+Hf2H讚8VI1PH}LzPH52 1XZfDkE18H2H(讗I1PH L1z<PH5 1_AX@L 21ɺF1L1 H5 E1Af.A耚UHSHiHtLHHtHHqt HE~u1H'vH[]fDHp@L 2111LCH5 AH[]ATIUH SHtkHHt,LHH1vH߅@u[]A\L w2L> H5j AL Q2111LBH54 A[]A\fSdʢ2[ff.HC=}4u 52u1Ht 2tދs21ff.ATUS1H dH%(HD$1D$f\$u%HL$dH3 %( H []A\ÐIFtHt$ ŅE$|$ Et'11 聕qA$|$ 蟹ŅHAL%2D$ H5 L P1A$Y^Hl$fD8|$ H诘xۋt$ 耺fL Y21ɺ 1L@H5C ADHL%2A1S L H5 A_AXߋt$ |@+jI,$膓AٹL/ P H5 1SXZߋt$ 1豹,@H2H(ٕ82L PH5j 1SDL$AY1AZJf.H52=2Lt(L 1L H5 AfDL 1N H5 Aff.~2Du 1fHu 1H@HfDAWAVAUATUSHH $HL$ IHH$AEEHdH%(H$1K$u\L21ɺ1L>H5 AD $H$dH3 %(DH[]A\A]A^A_fDDHAHH H ſHH HT$ ڕD$8%=`AH9l$HsHHV2H$`He1D1HL$`HAHl$衒yh8Dŗ11t$ DH]5IH$L 1BH5 AfIٹLd L2H5 1AE1@$Hc2uH$IH$I1Le .H52 1AfH$H(ďIٹL# P5H5 1ATD襖X1Z1E1fM)L H$H(8M$IٿH -H{ HDHLGPH H5] P1R>E1H K@AUATUSHH $HdH%(H$1H$IAHHuWL 21ɺMLp;H5 1AH$dH3 %(HĨ[]A\A]HH;xDHx2t!IL 11RH5[ Hx7LIZ1Ly H5 AFD[L8tML 11۹VH5 AҐfAWAVAUATUSHH $HH $HHdH%(H$8!1H$0HIHHA蘻u\L m21ɺi1L9H5W AE1H$8!dH3 %(DHH![]A\A]A^A_L$0LL%tL|$LL蜎A…u]D$(%=DT$ =`MxLu L2H5 1ADT$ @DL5q2LHf6MH1IATL H59 AXZADXLH޿谍y G8tHL2I1ATL 1H5 AAY1AZHuAbDL52HI1ATL 1H5} A_AXLD$ DT$ DT$ 蝍8ML0 ~sM8HI1AUH5 L AYE1^fH$LDT$ DT$ u$%H2DT$ H8A$0MH !Hv HDHL;PHm H5Q P1RpDT$,H 2fAWL=2AVAUATUSHHH2dH%(HD$81L#L9<DkLHE@H=@ DCSHDS$Dk Hk)A(Ds4AC8GH2H$LH1IAVLr H5W ARDT$$AUAH =*2tEDT$ Z}PLA ;L$H5 1Af.HLťI$M9t$DkLIHEH=Y -HD$8dH3%( HH[]A\A]A^A_DHF@H{@HfHDK0DC,HK(RDDA[]Zf.DHL$DHD$)D$H 2D$H $LA9AVI`PL H5 1AAYAZ1EEH 2H H=^4IANLl$ 1HTRL D$ 11H=4Hcl$ LljD$ H萍DT$ H9+D蚁2H$H(f8迆LTi1PH. L 41PH5 1_AXfH舵AŅD1b,D H$L(؈81HI1PH LhPH5\ 1AXZ_L A2L21ɺ[H5- A/L$L211@H5 AL f.H$L08m}IH5r HJHEHLfPH H5 P1RCAH L &CfH$L(蔇81H55 L 4P6H`PL_g1AY^H$H(K8褄=4H5Vq HHEHPHiL n4PLH5 1R,DT$,H e蒇fSHHdH%(HD$1ou+HT$dH3%(uH[f.Ht$H,ff.AWDAVAUATIUHSHXdH%(HD$H1=tDr4DE.E,3A<$Ht$<LjDl$S9L Ԯ2L].1ɺh H5 AE,13@%fA$DžHL$HdH3 %(HX[]A\A]A^A_fD蛃HD28L;ELK P AVH5 1A_E $o AX1L5 HH5 AQXZ&DL ѭ2LZ-1ɺj H5 AH-5 HAWAUASARAQE $t$8t$Ht$Xt$ht$xAPL WVH5d QR PSU$P1H$ӸHĠH-s |@H- l@H-3\@H-2 L@H- <@H- ,@H-$ @H-A @H-@H-qR@H-8 @H-2 @H-' @H- @H- @H- @H- |@H- l@SH28L;~EL P AVfDH-e $迁ff.@USHdH%(HD$1u"HT$dH3%(H[]ÉitHt$ɪÅu+L L21ɺ 1L*H56 At$͢ÅuL2H1AU L H5 AXZRڀf.SHdH%(HD$1Ht$D$nHT$dH3%(uH[聀UHSHdH%(HD$1Ht$D$ÅtD$u+EHT$dH3%(uH[]fDEDU1SHHHt(HkH{HCHCHHt HfDHH[]ff.ATHEHUHSHHt7H@ Ht.8thL2I11L; H5~ AHt0LS2H1ISL5 1H5P AXZH[]A\fH@Eu8u HtHUHHHSHHHtH@ Htt@HLͨ2I1SL 1H5 AXZHH[]fDH@H[]ff.fSHHHHD$ HtH@ Ht8tGLP2fI1ZD$ L H5J AD$ H[D@H[DAWAVAUATUHSHL LoLM9LAD#A#twf. yIHP L9u0DA uE(HH] L9}HIP uH]L9thIH] D#A#uL9ZHC@D HEtA tHHE I9ucxIHPfDLmE H[]A\A]A^A_fDA?t޺ LsoE;Wހ[yH  HcH>DEHL9tH DHu.u}uH] H[]A\A]A^A_E='^~t,E L9tHt1DP u2HL9t)Ht!#{@!փ@=@@uDž]EQ"uHSEL9C<"u/f.I9 BHڄw<"oHZ<\uI9zHBHHf]~%{}EH[EH}H]HCEL9S'ufD'HL9uHEHE HE HEHE L9YHMLfHXHDHڄt HZwHofAUATUSHH $HIHH$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1Ld$H\$ IMHH$H$HD$H$0D$D$ 0HD$asLh =H4$I}HHD17ÅuaL 21Lo H5 AH<$_sH$(dH3 %(H[]A\A]H<$"sH$HLHHD$H$0D$D$ 0HD$踈3L L 211H5 AJw@UHATSHH DdH%(HE1AtjEAAA}Lv2Lw 1QH5x AHMdH3 %(He[A\]ÐfZFH5T 6ÅuL 1ɺAEHIHHm{LeS(HCHH+Lu RLHL1211H5= AXZH[]A\@HS HsEH{0HEH{aS(HCHH+L RLHElH{11I6pHEA$tj"H{@HH508CHHE[PSHu$L =2L 1ɺH5D AsS(HCHH+L+ RLH@E,lH{1IpA $fZM{mS(HCHH+L RLHD@EHL1ɺHEHl{S(HCHH+LZ RLHS(HCHH+Lf RLHL 2L_ 1H5 Af.LL L 211H5 AdHsRfDH[:fDHC"fDH+ fD1HL [f.Ly1ɺL ۔2H5 1ADL 21ɺ1L9H5 1AwAVAUATIUSHHGHW HwH0L1ɺUHH{ S(HCHH+LJ RLHWL 21E1H5 AXZHL[]A\A]A^;HH{S(HCHH+L RLHRL1ɺJHHHq{S(HCHH+L} RLHM.fDH+}K8H{0LHOIH+CS(HCHH+L RLHkDLI1ɺPL 2H5 1E1Af HSfDS(HCHH+L RLH\?H; fDH#I${HC@tUH=IHI|$ t)L2I11L qH5 AMl$ fDHE1E1SIFS Iƃ HHMuIfHS{t]LHHu1ɺgE1L '2LH55 A HHD$SHD$aHfDL ѐ21ɺa1LQH5 A HMH{0 IHt{uHo2L1ɺH5v L1ɺn1H5X E1:H&21ɺ1LH5+ 볃1H2L H5 ff.AWIAVEAUIPATIUHSHHI}dH%(HD$81H4HIEL#HHC0Lc LcIL{C(Ds8WfH> HD$(D$D$H$LHHtx{ uHT$1HUHfDHJHzHBHBHHt HfDHUHt$8dH34%(HH[]A\A]A^A_@H2L*1ɺH5 HE1L1ɺH5 1L Q211ɺL H5V A1\H$2dff.fSu+L 2ù1L H5 A[ff.fATIUSHH5~ H;"u6L 2Ź1L_ "H5 A[]A\@H;HHCHt4HsHHCHtH@Ht HSHLн[]A\ÐHCHu1UHAWAVAUATSHXuMdH%(HE1HQHcEIHӅ HMHN1D H9DL}ID$ HuDpL-'H*ALDADuHCHtHHt HSLLH;>MM4$#L`HLuHHHH%H)HHH9tHH$H9ut H)HLHT$H"I4$HzIHU_xHU H!%tDHrHD։"Hf 1LLHH5zMt$ MJ1LLHH5.[sI~EuA>t1LH5 H#LH0XA>~fDHL HCHtH@Ht HSLLMd$Mt EAf.HMdH3 %(DAHe[A\A]A^A_]"L^H!L^HL-ED1H5(HBHL$EEI|$1HڍH>H;D1LH5 HEL 1ɺ^D1LH5i HAttLHMvMtXA>tR1LH5' H>uEL1ɺL2H5 1ADMh1LH5** HELJ1ɺfDLHDL 21ɺ1L H5 AE1f1LH5) HllEL1ɺEL1ɺL2H5- ADM1MEL1ɺqljELl1ɺx봉ELY1ɺ롉ELF1ɺ뎉EL31ɺ|xEL1ɺ~bEL1ɺLEL1ɺ6EL1ɺ6EL1ɺ $]@AVAAUIH= ATIUHSLH0dH%(HD$(1Ld$H$Hl$H\$Ht|LH1DH<$Åt2荘HL$(dH3 %(unH0[]A\A]A^f[L t211LH5t AL I21ɺ1LH5N A#\UHHHSHHtHP tVt9HL2I1S>L 1H5 AXZH[]HzH[]1HzH[]AT1IUSHH@HdH%(HD$81HHT$HH{Ht@It$ H{HHE HtVHD$HHL$8dH3 %(uaH@[]A\L 211ɺLH5 A1fDL ل2Lb1ɺH5 A1ZAVAUATUSHdH%(HD$1H$HIHIIH-[ %fDH<$2UH[HtiH 1LHL&lxzHsH<$LHuHuL 2L1ɺH5 AH<$T1 DHL$dH3 %(ulH[]A\A]A^fDL 211ɺL1H5 A1fDL 2L 1ɺH5 AmZYf.U(H=SHUHt0 HH耙HHtPHXHH[]f.L 211LY iH5 AHH[]L 2LJ 1nH5 AHwDHwHGHCHtHGHGf.1ff.fHHw@HHHwE1H7HHHwAH@UHSH~HHt&HRHHHTt:HH[]L 211ɺLH5 AHH[]H1L _211LH5_ Aff.I1Hf.I1H1ff.fHIо1f.HI11ff.fHE1HH5 HAHH5@HHfH1dH%(HD$81H)D$H|$1)$)D$ rHL$8dH3 %(uHHVHHcHH5kHÐHHH5Of.HH52=ff.fHH5{ff.Ht7t1t@HHNH1ff.fHE1HH5gHAHH5D@HHcHH5HÐHHH5f.HH5rff.fHH5P[ff.SfHHHH@dH %(HL$81H)D$H|$1)$)D$ mHt8HP 1Ht uHtHRH\$8dH3%(u H@[Ð1SSfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht8HP 1Ht uHtHRHH\$8dH3%(u H@[1WSSfHHHH@dH %(HL$81H)D$H|$1)$)D$ MHt@HP 1Ht:tH\$8dH3%(u$H@[fHtHRHD1Rff.@SfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht0HP Ht'HtHHL$8dH3 %(uH@[@1/Rff.@SfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht8H1Hz tH\$8dH3%(u H@[fDHtHՐ1QHHf1HdH%(HD$81H)D$H|$1)$)D$ HHL$8dH3 %(uHH/Qff.@HWHÔHtHAT{IUSHc}HLc[…!9]A\!fAUATUSHHH0IAHHH3HtLHEHC(Hs E(HtLHE HtUHsHtLwHEHt6EtHsHtDLUHEHtHH[]A\A]fDL y21ɺ`1LaH5 1AfDL y211LQ MH5 AHH[]A\A]L qy2L} 1RH5s ANf.L 9y2L 1WH5; AfHSATI0UHSHDHHt,H}L耎HHtPHCHC H[]A\L x21L oH5 AH[]A\L qx2Lb 1۹sH5s Aff.fH 鎎ff.HtwHtG1ff.fHGATUHSIHt>1Ht/HHHCH9uH3LH=FoHH9uL[]A\L w21ɺ1LH5 AfHWHt?H9u*@H9tHHBHufDHFHBHBHG1ÐAVAUATIUHSH:Ht}HHLI4FtT1HvLLGLLHI Ft-LLHE1ɅuHJ4+LL)E1Ʌ[]A\A]A^@[]A\A]A^AWMAVIAUIATIUHSH(H?DL$ dH%(HD$1职HH}LH蹋HCHH}L蠋HCHfAoD$ H+H{HLl$CfAoNK(fAoV fCpL{xS8(H{XHAFAVLH}HH H HH%H кHD$tgA<$HL$dH3 %(HH([]A\A]A^A_fDL u211L H5c A/L t2L H5< AH}H1ˇjfDH}HLQM5L t2L H5 AH}LH}H1cIJfAWIAVMAUAATAUSHLD$|HHHuKL s211L4 H5> AH%H[]A\A]A^A_DHŒtEH0ŅuZL1ɺL us2H5 1AfL Ys21ɺ1LH5 1AkLH&ŅMH芊H|$H譈Lu IHudL r2H5A 1AH,L r2L1ɺH5 AH|$Pt8H`H|$HHT$PHHuL \ffDL1ɺff.fAW1AAVI1AUEL ATAUHSHHq2DL$ IRVH51 ZYyHDHH衐uMLq2I1E1L2 H5 AHV#HD[]A\A]A^A_@DHetH9+u$L.q2L?1ɺ H5 AMtALHݿAątD$ uvH6.1AątDAfDH\IHp2I1E1L H5 DH*ff.AVAAUAATIUSCxHHH-uAL "p211L H5l AH![]A\A]A^DHtLH~(Ņu`L o21ɺ1LAH5 AL o2111LH5 A[]A\A]A^DDH,ŅtKfM1L*o2L+ H5 Aff.@ATAU SvHHH׍tSDHtDH(u$L n2L 1ɺH5 AH+txH[]A\L yn2L' 1H5 AH1= H[]A\DL 9n211ɺLH5 AH[]A\fL n2L1ɺH5_ Af.AWAVEL AUAATAUHSHHm2D$X $1LL$ID$1R3VH5 ZYuHHHH艄ADžuJI<1LLm2L H5 AHHD[]A\A]A^A_@DH uqLm2I1E1L AH5H AHl2I1E1L 6H5 oDDH譋tH&u$Lvl2L1ɺFH5 A4$DHk"u$L@l2L 1ɺIH5 AT$Ht$PHADžu2Ll21ɺL1LH5W AH )ADžtQD$`uYHt$HTADžsL21ɺULk2H5 1AHfDL1ɺOr렐HLUk2A1hL? H5 A1H@SHOHHbDK4DC0H HHDHH1PxH[HfDL j211ɺLIH5 AHC[@AVAUIATUSHH0w40dH%(HD$(1HD$HD$ aHHL$HT$1HLL$ LD$H'Ld$MI H=یLtoHj2L(HHH5X ATIL 1E1AY^HHT$(dH3%(DH0[]A\A]A^ÐH|$ L3nAąu\L i21ɺ1LH5 A@L Yi21ɺ1LH5 E1AmfH)i2Lt$ HL AVMMPLV 1H5c AXAZHh2L% L(>DUHSHHHH8{HtHXHH H[]@L oh2LW H5 AH1[]HGHHWHH9u HH9tH;pu@UHHSHHTtH{XHDH[]DAUAATIUHSHHH8-~HHt5DhHx(L`4HH5HH[]A\A]L g21L M H5 AHH[]A\A]fATIUHSH?H }Ht)L`H{(HHh譾C []A\L f2L H5T A[1]A\f.AWIAVMAUEATAUSHHnHHH葅u]HA\ATLS Llf21H5 AXZH;E1>HHD[]A\A]A^A_DH;DEtH;Euyd#HAhATL2 Le2H5O A^_|D1ɺXE1L e2LCH5 A]@[ t_H;vHt$@H;tgHD$@A@9tkHAuPL DHAbATL. fHAnATL^ HD$@@A9tHEzPL RH;=|H;I}H;IHT$HHSf.HWHHOHH9UHSHHH;rt]HH;XtHH9uH[]H;Zt2HH9uH{XHCXH9tH9ou %DH;otH?H9uH(fDH[]@UHSHHHHuHH[]醼fDHc2HHL TIH5 1H1[]ÐATIUSHHA$u@9uTH[]A\@LAc2HTH 1LLL 1H5 AH[]A\@HHHL1H: Lb2L HDLLPH5& 1AXHZ[]A\@L b21ɺ1L!H5 A)ff.fAWIAVIAUATUSHHHw40dH%(H$81HD$ HD$(&HHL$HT$1HLL$(LD$ HLl$ MH=LL%a2M$1ɺH5" 1LL$(L% AHt$(1HT$0耤hHpA?H$0E1PAA>@HEL} 1RH5 jP1A$H EH$0H81H$01@L%`2L- M$HLT$HAUI1LT$L H5 AXHZL1ɺ1H5 1A$H$8dH3%(HH[]A\A]A^A_fHELi 1RH5 jP1A$H Et6A?HN H 8 s4HDȋ{01ŅEA>H5 H ! s4HDȋ{01JŅL)1ɺ1H5 A$mH$0E1PAfDL%Q_21ɺ1LH5 A$@E1L1ɺH5q A$HfDLy1ɺ1H5D A$4fDUSHHN4V0 uBŋC4HL^2LKL PC0H5 P1sAH H[]AWAVAULo(ATUSH8Lw(H4$dH%(HD$(1M9ELIMIH˺Hl$IWHH'/Hc;L1HH?H)H<$aC6Mm1M9AD$IuvHT$ T$ HUHc;LH UMMIH HEH)1H<$ByL1ɺL 0]2H5 1AAEHc;L1HH)H<$B4Lv1ɺDAH\$(dH3%(DubH8[]A\A]A^A_É$L61ɺL\2H5 AD $L 1ɺ9$L1ɺX2Hw1HAH AUUUUUUUUDAA33333333DAADAAAȉсUUUUUUUUʉ33333333ʉʉAAAADPHVH9t H*@ff.@AWE1AVAUATUSH8Dg dH%(HD$(1D$$D'I1GtDHIEEDChEmG! HD<NHA?DK8ANjCD$ 0HqZ2LLH$D$ nH D|tD$ HH H H1EH ?KL$D$$1ɺr L L1H5[ AaHD$HEL|$AL=L$L L w H5 ALz HcD$$LH)I|v7|$ u01H >F D$$LD$$HH)I|DSttKh t4HA D>K D$$LD$$HH)I|EE1fDAE9DHLsLI|DH)H4 1>%D$$D$$Ht*1HH =D$$LHc|$$H)LKht*1H, =D$$LHc|$$H)L|$ u6v11H {= D$$LHc|$$H)Lt*1H @=SD$$LHc|$$H)Lt4H DE1D=D$$LHc|$$H)L1DHV<HL$$LLHD$$ADžADHL$(dH3 %(D)H8[]A\A]A^A_f.fD DDDDChEkfDEH8V2H5 1L IH$1ACHc|$$LDK8D$ D$ H)L0D$ f.LY1ɺ H$H5" 1AHU2LLH$L= A9LI|H)HHs1L7yD$$LD$$HH)I|L1ɺ D1H 6DD$$LD$$HH)I| !1H x6vLY1ɺ D1HY J6 L+1ɺ L1ɺ H$L11 H5ſ NL1ɺ yL1ɺ f1H 5D$$LHc|$$H)LL1ɺ $Lo1ɺ 1H e5D$$LHc|$$H)LL-1ɺ L1ɺ L1ɺ L1ɺ L1ɺ L1ɺ pL1ɺ ]L1ɺ JL1ɺ 7L1ɺ $Lo1ɺ L\1ɺ $ff.AWAVAUATUSH(L5N2H|$IdH%(H$1XL' 1ɺF IH5˽ 1ӿMVHD$HHD$H|$p0-mH\$L|$s4L0mtLÅ H|$HD$E1LHHD$L9HD$X4@0$\$HIHx AMD$D H HcH>DH|$I#Lw O IH5 11H|$H$dH3%(&H([]A\A]A^A_H$IHD$XHD$`HHD$h6 L/1ɺ3 H5 AL1ɺ H5׻ 1AL?L1ɺ0 1H5 AL1ɺ^ 1H5 1Af.H$I@H9AIHHL$H$Ƅ$ L\$ L\$ E1MHH HL11fAMwH MHHH HDATLo  PH5 AuAWD$,P1DL$0AAEHH0HLIUH|$MLjLM}MmL;l$ H|$uLC 1ɺa H5 AHD$RH|$ÅHD$ǀMf.AL$I8LL\$ D$(AD$0A|D$4AD$8AxD$L\$ HL PR 1H5 AHD$hIEAYAZL\$ AeAIHt!HrtHrHWHEAH5 ELH MHDHA HQILRH5 PAPAHP1#H04Lm1ɺa 1H58 A@L$IuHLLD$(LD$(J A}<AU@HHc|$DHRHL$0H~ H)DHPL1#A[Z L1ɺ q@Lɼ1ɺ DL1ɺ uDL1ɺH5a AL|1ɺ hLi1ɺ H51 ALL1ɺ 8L91ɺ H5 AL1ɺ Aul1D$(D$ DAELM H5 HD$PD$PHw LL 1AL AXAYfDƄ$L$)Iu`HL$L$0L L$0L DT$ HcD$PEHHHv AH)I<L1!& D$PHHcH)|$PLI}`t5L$1HL  D$PHHc|$PH)LAMh1H%  D$PHHc|$PEMlH)LEtDD$ E9AEt mL$(t*1H/G D$PHHc|$PH)LAMp1H   HL$PHLLD$P HcD$PHH5 H)I<1L1ɺK 1H5y AL 1MH1HLi1ɺ DL$IuPLL\$(L\$(L+1ɺ- H5 A9Iٹ6 1L2 H5Ψ AfDLa1ɺY H5 ATfDH AHe EHMHLHEAHDA H QILPAPAHP1\H  HHHEH)I<AEAHݙ PAPAPAPAP1H0Lҷ1ɺv 1H5 ADL s@A0HL$ IMHHc L1Å' HcHAp1H)HڮLV1AEtHHcH1H)L% AUtHHcH)I<ZHܩ 1ÅIHYHHHHDHcH)I<11HHAtHcAI<H)1iAtD t0IcHDL$ HI H)I<1.DL$ A@IHHXHLl$ EfHC Ht,IcHL@H H)1H LAH[HuLl$ HcHA|1H)H L A}HcD$PL  @LHt$HL\$ F{L\$ yHD$HHHD$XfDHcHA1H)H L AHcHI1H)H L AHHcHA1H)H Lo\ A}HcHI1H)H L/d AHHcHA1H)H2 LH AHcHI1H)H LAH!HcHA1H)H§ Lo:AL91ɺ 1H5 A @H|$I[L I IH5ˢ 11=Lٲ1ɺ DL1ɺ H5 A3fDL1ɺf H5a AgfDLq1ɺ 1H5< AD@LI1ɺ 1H5 A@L!1ɺ H5 AfDL1ɺ H5 AfDHcHH 1H)LÅL1ɺ 1H5x AfDLy1ɺ, 1H5D A@HcHAx1H)H5 LG\A=Hc|$PH1L$0HG H)LL$0EIu`D$PD$PHL$L$0L{CL$0D$PL w@L1ɺ 1H5l At@Ly1ɺ8 1H5D AL@1Hi ZD$PHHc|$PH)LfL1ɺ6 1H5 A@L1ɺE 1H5 A@Lɯ1ɺ3 1H5 A@L1ɺ 1H5l A@HcHI1H)H LoAHHcHI 1H)Hɢ L/fAHHl$H|$HuÅt7u$u0H|$I.#L 1ɺj IH5 1fH|$6HHD$L9HǀM&HML-&H|$HIL AU{ H5" P1AWAH HHD$ HI.I\L IH5̝ 1LǀfDH|$E0EqHcHHg H)I<1ÅLL1ɺ 1H5O AWt$HLL\$ HL\$ 1HL$XHT$PHLL$hLD$`tHt$`L\$ HtH=yRXHD$XJ@HcHH 1H)L)AHXHD$X$fDH|$I.LW T IH5C 1f.L #L:1ɺ> 1H5 A L1ɺ 1H5 AL1ɺ 1H5 ALΫ1ɺ 1H5 AL1ɺ 1H5u A}L1ɺ 1H5Q AYLb1ɺ; 1H5- A5DL91ɺ/ 1H5 A @HcHHȞ H)I<1 LAHfD1HޙLê1ɺ@ 1H5 AfDHcA4HHY H)I<1ÅCLm1ɺ 1H58 A@LI1ɺk 1H5 A@IMx1H&D$PHHc|$PH)LL1ɺH H5 APL̩1ɺ 1H5 AL1ɺ 1H5s A{L1ɺ 1H5O AWL`1ɺ 1H5+ A3L<1ɺ 1H5 AL1ɺC 1H5 AL1ɺ 1H5 ALШ1ɺ 1H5 AL1ɺ 1H5w AL1ɺ 1H5S A[Ld1ɺ2 1H5/ A7ǀM&HHHD$H|$dHE1H RLV { PH5Ǘ 1AWAH 1H HAUtHcH)I<L1ɺ 1H5m AuH 1 ÅLf1ɺE 1H51 A9H9 1K ÅjL*1ɺA 1H5 AL1ɺ; 1H5і AH|$/HIHRL! { PH5 1AWAH uL1ɺJ 1H5f AnHD$L- ǀL\1ɺM 1H5' A/L81ɺ> 1H5 A L1ɺC 1H5ߕ ALl$ L11S H5 ALǥ1ɺO 1H5 ADUH="SH7HHH<<HHtlHCHx`G}H{p>}H+=HǃHǃvHCHvHCHHH[]DL a%21L hH5 AH7HH[]DL !%211۹LG hH5k AHH[]wL $2L H5< AH;16HH[]D}L $2L H5 AH{vH;1V6Ht'SHHzvH{qvH;[(6ff.@HfHfHǀff.Hǀ ff.Hǀff.H@AUATUSHHDgpfA9tH|$Hm @1fDXAV(s4{0HL$H-= 2A~Lew}8$L1ɺI1H5x AL1ɺ1H5Y E1UINMF @1H|$H ^QANH|$@1Hp =0ANH|$@1H@ ANEF@1H|$H H|$HO @1DA~tYM6M9}ǃfDH-2L1)H5R Uf.HH%ADžL|$IN I9tH2HHL$H(uHL$L4 IH5 1QAWE1XZ$H W2HL!H)H UAWIt1L: H5 E1A_AXǃ H2HH(ɲHL AWImH5. 1AAYAZsH2L GH->IqL-Ց HE1ZHL UIH5Ō AV1AUAH H<2L H-L5 L-H2H-m L5L EnHԱHLd AUI91H5< AYEN1^ALk H5 U1ENL CH5 UL 11DH5ϋ URH- L5L5 H- L5 L-H-L5 |L1ɺHGHGxDHt5HB`H`H9uHXtHH9tH;xu1HGHHHHH9utf.HH9tH;Pu1ff.@UHSHHHHH9t@HHx茶HEHH9tGHHHppHHH[]韲HtH[]1HtAWAVAUEATIHUSHHxHH4$L|$0DD$ LdH%(HD$h1HD$HD$H HD$ H%HD$(H H кHD$0tlIHEtKH<$LtdH|$HtH\$hdH3%(LXHx[]A\A]A^A_fDpltD$ AFlLH<$fAFpcuL(1ɺL 2H5 1E1AnfH DHD$)D$0)D$@)D$PHD$ HD$(#Dd$Hl$LHT$(Ht$ E1LDL$ H謢L1ɺIHaDhlH<$H;AL$}HD$Htstml$ E1DAALHTHHHH  IHHD$AD9(wMRDI$LHpuL 52L1ɺH5 AHD$HL$ E1ɉH|$PDAWLD$8_AXL 2Lc1ɺH50 AL 21ɺ1L)H5 AHdH%(HD$1 HGt0ЉHH HH%H HH кH$~iHL$dH3 %(uH@AWAVAUIATUSHdH%(H$1Ht>Iu8M}H$dH3 %(LHĸ[]A\A]A^A_HHjIHt0ML 1ɺYLp2H5ԅ 1AD@HHD$6H$H-LI1IT$HT$MH,ÍPT$HH|$HH\$ LM)HI}HBD$ AiIHt9L2H1IUiL{ 1H5 MAXZH$Ht$LH,$I}LHhIHt,ILr{ 1ɺufDD$MLv{ 1ɺyDAWHAVEAUIATIHULSHHIܬHH;LIHtXIGPHHaAąL1ɺ L 2H5 1AHD[]A\A]A^A_fDM Lz L=2H5 E1AfL 21ɺ 1LH5m E1ADH;LHt`IGHHHAątj1EAG~ A$A[A]IHpAw0H-Aw4L-LLL$nD$EH|$P8HHD$/HD$ HD$PDEH|$XE1H\$0L$I$LHpNt*D$MA$D$A$f.L1ɺL [ 2H5z 1AD.L%/ 2LXr H5z A$L1ɺ1H5lz E1A$8HD$PHL$hADH|$HPAVL$ZYLL$X8L% 2Lq H5z A$t@LL$XLlr 1FH5y A$LHH|$HH25(LL$X1Lq @H5y A$H|$HHuAW4Eo0LL$XL r MH5Jy A$L_1ɺR1H5*y A$L螻H|$HH$脻$lL 1ɺR1H5x A$LLH|$HHLl$(H\$0l$8Ld$Ӄ$It?Ld$l$81ɺcLl$(H\$0LH5]x A$Hjt$(D$(P8H(HE1E1HwHHDHE1DHwщHH@AWIAVIAUATUSHH|$dH%(H$1HD$8D$$HD$8HD$fHt$H|$1HH#HIHHIHHH LLH蜐tHHB`H`H9uHH9H;XuHL$@HAt$1A|$jE1E1A\Z6l$@5D\$DE'vDT$$EWHDT$XMH| Dd$\H52L| LH5Kv L$(H zD$,HEхHQ| HE1RfP1ATARDT$8AH DT$HHDH}%M1H_2Lho nH5u H2D$\H72M麢L{ PD$`H5}u P1ZYD$$fDL1ɺuL 2H5Gu 1ADLQ1ɺzL 2L21ɺH5t AwHkXHCXH9Ld$IFDLLHBt&H}H;tLH{HHmI9t;H}6HuL 2L1ɺH5`t AHmI9uLd$\f.HD$8HPHt$H|$1HHuHHtLLLHnt1HtLLHuL1ɺ=f.I1ɺL *2H5s A[L1ɺL 2H5js AD$$H$dH3 %(D$$JHĸ[]A\A]A^A_L 2L:1ɺH5s ADH"Htu$Li2Lz1ɺsH5r A|$,t$(?H|uH HHt$p覶HAEfo$foD$pfo$CK(S8DKD$$Et DC EurH2HH(}L1k IH5q 1Ճ]Mi1HW2L8k H5q LLHjD$$oL 2L1ɺH5mq AHͻL2LGk 1ɺyH54q AHԻlL2Lj 1ɺvH5p AC~ff.AWAVIAUATUSHH4$Ll$HHT$L$dH%(H$1H$HD$HD$HD$f1LLHHHHHCHIH_HH^HT$H4$H蝉tHL$PHu}jE1E1HAZA[LDL$PE^DD$`E|$tH5LH0Hw)8L$`H#v >HMH2L v RD$|H5No P$P1LZ1ɺ(H5'o 1H D$fL)1ɺL 1H5n 1AeDL~1ɺL Y1L~1ɺH5n A'L~1ɺL 1H5n AD$@H$dH3 %(D$H[]A\A]A^A_LM.IoXIXL9H\$8H$Ld$ IHl$Ll$0Ll$Lt$(HHHbt\I|$tIHHpxjE1E1LA[Z^D$Et$vM$$M9t@I|$HvL 1Lx}1ɺH5Em AM$$M9uH\$8Ld$ Lt$(Ll$0HtHT$H4$H:HDCpLT$lt$hDH\T$TtD$Xt HHt9HHЅu$L 1L|1ɺPH5vl A1H9D$HT$HH4$HiLZ|1ɺYfDD$lML=f !PD$pPL1H5k 1AY^D$cD$lML=f EPD$pPHI1Ld$ 11Lt$(Ll$0L{H5k DL$ED$lMLe 6H5Uk PD$pP1_AXD$H1Ld$ 1LK{Lt$(Ll$0H5k Ld$ Ll$0MHLt$0PABHp1L)e H5j PABP1LL$ H )t$l|$h2H q t$l|$h<3DHq 1DAWAVAUATUH-lzSHHhHt$Lt$HHT$dH%(HD$X1HD$H@1HLIHLHHT$Ht$H\t1LtHT$Ht$LXuD$$1ɺ L -1LyH5i AHL$XdH3 %(D$$ Hh[]A\A]A^A_DI1ɺL 1H5>i A#HD$PD$$1HD$HH$D$ 1HLIHWA9ohuLHHT$Ht$HNtLRHD$H\IHD$PL%HK@H<$1H IHM9tLHMHLuID$ f.L1L2x1ɺH5g ALL\$0LL$(ŵLL$(ALUEL\$0bIILJIGAGA O$HAW4Aw0MOEAIPAGpPIHPH t$$AA3AOD$$AW HT$Ht$LD$$L1Lw1ɺHH5f AL Y1Lv1ɺH5f AD$ |pML1IHEop1Lm HD$@AG4H5>f ATPAG0P1LL$8L\$HAH L\$(HHt$HL\$0HD$( LL$(L\$0MMϹLL$L` H5e L$AL0L$AE4HALy` -PAE0H5ve P1LL$8AH D$$L1Lju1ɺH57e ALLL\$0LL$(LL$(L\$0MMLu1ɺH5d L$ALRL$fLI1LM#Lvk :IH5d 1AD$$l@LL$1L$L^ MH5Hd AL$L1LSt1ɺH5 d L\$(AML\$(LL\$0LL$(腮LL$(L\$0u1LL$0L1ɺL\$(H5c ALL$0L\$(Ht$8LAL\$0LL$(HCLL$(L\$0LL$ML$MMf.AWAVAUATUSHH8H4$Hl$ HT$dH%(HD$(1D$HD$ D$D$@1HH{IHvAAE1I}HT$H4$/|t1Lq'E}EdAt ǃAE$uEEL"REEBAEA M$2HAU4Au0MMEAI}PAEpPIEHP衄H %Dd$Et+EEtEUEtEM EifEEDD$D$AE01LJHT$H4$LADžLoq1ɺ L 1H55a 1AL51MM11Lg VH5` A1IHIuHwMM^L[ H5` AL+Lp1ɺ 1H5` A@HL$(dH3 %(D"H8[]A\A]A^A_fL8L%1Lbp1ɺ H5/` A$HD$GL0p1ɺ H5_ A$@|$t$tlKHH+tEL 511ɺ 1LoH5_ A1HT$dE1IuL A}AL趥MMoLZ B@MMY1LY H5^ A*DH8D3@MMcLe fDLuL%1ɺtH5e^ AL?IuL{D$dMMLY H5^ Ac1HlCu%HHtH1HADžvAMDD$L%I1LM4$Lud IH5] 1AH0D$uLm1ɺ H5Y] A$]DHT$H4$1L L51LGm1ɺ H5] AHD$-Lm1ɺ H5\ AADžLH7LH tALU `MMj1LW H5z\ ALHBL{l1ɺ" f.AVIAUIATIUSHdH%(HD$1HH$;f.HHt[LLHeu1Hu1LHRHHu1HL$dH3 %(ukH[]A\A]A^H!1HH(LoW 1ɺ7 IH5i[ 1ոfD뙐LLHnAUIHATUSHH诃HHH;LxIHt@HEPHH1ŅChADŽ$H[]A\A]fL91M11LQ e H5Z AH[]A\A]DLj1ɺb L 11H5HZ AH[]A\A]DLQj1ɺk HAQEE1HfDHAQA{HfDHHkHtHf.L 91 Li1H5Y A1HHH HtHf.L 1 L]i1H5/Y A1HHH諁HtHf.L y1 Lh1H5X A1HSHLHtX8[DL !1Lh1ɺ H5wX A1[AUIATIHULSLHHtLe1H5U A1HAWAVIAUATIUH-Z^ S1HL:H|$DH$HLAŅuH H^ H|$L4}HAT$fAPhAT$P8IT$HIT$ @ HAT$(AT$4AT$0 IT$@PtHD[]A\A]A^A_f.L 1Ld1ɺNH5_T AL1M1E1Lj[ PH5)T AfHhfdH%(HD$X1HD$pH$HD$D$D$8L$D$(HD$HDD$LL$HD$@3HL$XdH3 %(uHh9fAWAVIAUATIUH-j\ S1HL:H|$DH$HLAŅuH H#\ H|$L4{HAT$APhAT$@ P8AT$AT$AoD$ AoL$0AoT$@Ao\$PAT$`AT$dAT$pAT$l IT$xPtHD[]A\A]A^A_fL1Lb1ɺH5OR AL1M1E1LZY H5R AfAWAVAUATUSHHHHIII̓MHtvHtKHtEIL;N LB111H5Q AH[]A\A]A^A_fDHt$PH=\U HHD؃$?$ vhHh D$LM L111H5 Q A^_fDIL>M .1LLLD$nyLD$HII<$LLD$,LD$HI@HLŅuVL`1ɺL 1H5eP 1AHj@LL D$@I<$LI8HHLYŅu{L`1ɺxL y11ɺ1L_H5O 1A$MLV L51H5O 1AI<$LIGPH@HLŅDHD$`A_tH|$XALJtIHD$hI HD$pI(HD$xI0$ApHD$PII$Ht$X1H8dIHH@HL@ MAL ~8IPAtH@ H@HL@ MAH0L€tAML4K MLCK jL/^1ɺ$9HAtHuvH;I<$H訸HHLHLaÅWLkHI<$LHH$hÅZHuH莦D$%=`2IL> L111H5r> A-fL 111L= H5C> AH$dH3 %((HĨ[]A\A]fDL 11ɺ1L!NH5= AILrIIٹLE )LM1ɺL +1H5= 1A@DLM1ɺHT$(I<$E1E1LHHH  HH*L 11ɺ1L:MH5= 1A菣ff.@UHSHH{iHtvP v>L W111Lo< H5< AH[]f.HHsH;H1HeÅt:L 111ɺLiLH5=< AH[]ÐL 11ɺ1L9LH5 < AbDHHff.fAWIAVAUAHATMUHSHH(LL$MdHH;LIIHtRH|$`HL 11ɺ&1L~KH5R; AH([]A\A]A^A_fDM!1L1L2C H5 ; Af.L 11ɺ1L KH5: 1AfDIHŅHD$`EoAoPAo` AH@0)d$IHD$`@8MAHD$IAǃDL 11ɺ)1L9JH5 : ADUHSHHdH%(H$1H衡xmT$@u&H$dH3 %(HĨ[]D1Iٹ"L 1LsE H5E A1H1H(18芜;IٿH oH1 HDHLPHN H5D P1R1H B胟AUATUSHdH%(H$1?u/H$dH3 %(HĨ[]A\A]DIHHUuD$%=@tL-1M11L'D .H5C AUL?HHHu/H{/7HHtg}t޾HyН8uHuLG1ɺ=H5tC AUH#I]NDL転xHf.[8I]ugHϘ1LvG1ɺfH5B 1xf.LQC 12H5B AUI];}H 'H HDHIPHL1PRPH5lB 1H HI]?fDLLF1ɺMDI]螙}H HL HDHIPHdLPR@^謜ff.AUIATL%UH-SH茗HHH踠HHHH€tHƹLtH1taH1Ha8躘Mz1PH0L8{PH5A 1XZH[]A\A]ÐH߽賝uH[]A\A]H11H8J1MqPHH5@ PLz1Y^ff.USHHNH߉Dt u臚H[]D H[]ff.@AVAAUIATUSH`dH%(HD$X1莗HD$AH$HD$1H葘)ԙ8 te t`tH-l1L? 1H5r? U賑uGHL$XdH3 %(}H`[]A\A]A^fDA~褖]CH]8蘖M1PH LyPH5> 1X1ZvDH1H8JHMLL? P1H5> A]1A^'fD1蚓Hl$ 2L A2H1I_A$I!%tHDIT$LDII)L(IHL911譖߉1蒖¸DΗH-w18LeHMLv? PH5d= 1A_AXLԑwLe8̔1MPHUH5= PLBw1AY^f.+8H-1ATM1AVL=> H5< UAYAZ\H-1Le0HMLb= PH5{< 1AA[A\蘖H-A18LeHMLH= Pc8H- 1Le豓HMLC= P.H-18Le|HML= P^詖fAU1ATUHSH8dH%(HD$(18ÉH1$HD$HD$Dx@詍t&L .11ɺ1L?H57; A1f<$uKL%18M,$虒HIP1L&= H5: AXZ&t"L;?1ɺ1H5: A$f1HL$(dH3 %(u H8[]A\A]nf.@1ffDATUSHPtEH1E1DHH9HBAD$H<@IHHHPuH[]A\fD1H[]A\fDAWIAVAULoPATUSHG(LwPAĉD$ AM9t_I^InH9tIEtHC@) t IN(@HI~8uAF0tH{^HK9A}AHH9uM6M9uDt$ AEw(H[]A\A]A^A_H6H?1Mt+MHMQMt }@tw1@ /@u&~ "f(\fTхf/1MI@1\fTf/fUHHSLH|¸t1HtHCHH8[H[]@~ xf(\f(fTf/&f/иw?Sf/w1Af/w\fTf/Af/gpHH9t1MtI@H9fDH HH9r H;Nv1I;uHFI9Df/wBf/w4A\fTf/.A\F1fTf/D^f/8\HfTf/vff/Vf/\fTf/1MIPf/wf(\fTf/Vf/\1fTf/H HH9rH;Nj1M_IHH H9O1H;NÐXf/V#f8f/HH9t1I;1I;øfDHHpHHx限fHHHB@8AVAUATD`USLr(1Li(IHPHx IDj(Hp `t1HHH9tn@tNH9[]A\A]A^f. t?@tOD[]A\A]A^f.H9[]A\A]A^@HCI9t*HV[]A\A]A^fD11랐SHwHHtH?{HCH{PHC@HK@H9tDPPHH9uK([ÐSH׉H@H2HH JuH[fDATUSHHG(u []A\HoPAHAuHC@HK@H9t&P(uցD t P(HH9uH{PH9tHGHOH9t;HPHt':t"HpV(tV(f.HH9uH?H9uQL 411L5 H5X A[1]A\ff.Ht#SH_H^u H[1[@1DAWAVIAUATIULSLH(L~H$L$ dH%(HD$1HD$M/Mu_IM/MtLL\H9uHHL詆uHL$dH3 %(L&H([]A\A]A^A_A$H$HLPHDl$ ILL$D;1LIDH0A҉Ņ~D;Ll$xDH1A$L OW LKDmHIF`HH:W LDʃtDH< PL4 1H5V AD;XZuE1fMT$:H8 PH5V L3 1AD;Y^AATIUHSHH>K1LHHHu.uHHHADHuI$H9E[HD]A\USHHt,HHHfHHtDZ uH[]HAWAVIAUAATUHHSHH]IHt:DEtDmtHHLHIlt(HH]Hu1MtM>H[]A\A]A^A_fMtK'IEH[]A\A]A^A_fAWAVAUATIUHSHLn8 uBL 1ù1L33 zH5T AH[]A\A]A^A_fDH5CHt1LHu?L 8111L2 H5T AHf.1H5T HotH5W HWtH+IHtID$(L51IT$DH M>Z EtBHDK1HoLdPH5S 1AIT$ID$(M>_Z AXHx(tIHx8tBHDK1ɺH3RH5S PL1AID$M>H YX Y^LH1ɺAUD 1LH5dS AID$LH@ XZAt*HHxt;0uf;0t H Hxu1H-fDAVAAUAATA0UHSH?HHH\1EtoOdDcH}pIIAHA@ Ds,A0CCK(QHC HA H}@Dk(Au Hx H[]A\A]A^@HE`fH H[]A\A]A^@L 11Lk0 BH5R AH[]A\A]A^MH31L%i1Lb0 H5Q A$1L01ɺGH5Q A$H}H14H[]A\A]A^AUAATUHSHL%1uLg`HE@HM@H9uDHH99P,u9XuEH( u)U8D ru8PH(H[]A\A]@H[1ɺ%Lq1HL/ H5P ML1AH[]A\A]DEt/H[HA EH[]A\A]H[]A\A]ùH}H;L 1Lv/1ɺH5TP A12fAWAVAUATUHSHH8LfPH4$L$$DD$ MIHE1fHgH9HBAEH<@IHLHPuLkpI}t,@I}/HH9HBI I}uMHCpE1H$L51HD$HHD$IHl$mHHT$HHHVHLO MPH5@O 1RQ1sHSDL$8AH0AEH@IHH$H{P3H|$MHHL`HMLDM9A?tI1ɺH5N 1AMMLN 11H5N AL~1ɺH5pN DHHa- PLN 1AQAZYt$$Mtb}tYL}LT$(L~HMH5N VL}N H5 N t$(L$ Q1)1RLT$HAMH D$ jKH)ʁ@t8vaHM t'H4PtHs HJfHEH5HM H M HDH5HtɃ HOlHeHEDL, 1ɺ1H5M A@LopI}9H8[]A\A]A^A_fAVAUAATAUHH=i1SLu`HLEDLH9HHBHiL "111LH5L AH5 1EDHH[]A\A]A^#L ٫1SH1LJoH5M9wtH}H5{追tM&L zH}LH衽uLM 1H5I LOJ 1ɺ1H5aI H-)1L>J 1ɺH5>I 1L4J 1ɺH5 I 1L 1L%'J Mt8HHu1Mປ1H5H LMY^MuL1ɺ1H5H H-]1L* 1ɺH5H 1L 61L%I Mt:f.HHu1M1ɿH5IH LMXZMuL HLO1[]A\H5H A]1A^A_AH}H5pK H}ʼALIL@t<HH t'HFJtHH\`HEHL[H 1PH5G 1AwI AVDL$(AH}LH A?:Le1ɺ1H54G Ht HfH_HEiL( H5F LJ 1H5F Cff.@AWIAVAUATIUSHXH?Ht$ HT$(LD$DL$@[HLII<$pH5L( IIEHDIFH<@HtL( IHI<$EH|$H_:vHD$8II9c1Ld$0L<$AD|$@D$Ll$Hl$DHEH9$DHsET$H@M,IuEuHHt$uHt$HHHD$0H8>ET$D9T$DD$ImAED$fML$$Lt$L J Li1H5D 1AI<$L1ZL"uHX[]A\A]A^A_ÐL )111L& H5D AHL$ HHIEHD$(L(fDHD$0Ld$8DT$Ht$H8L9D$DT$ImAEAEAD-D$|@L HHHpI<$HL$ HIEHImH{E)tHEHD$(L(Ll$Hl$DDLd$0H LE11ۺVxLLt$ML$$AI7EGIAT$LHIFIT$HPIE9D$@tI4$HHt$sHt$HHH$H8EGE9DD$tJH$HT$8Ht$H8̶IDD$LHIF\$8HhjMILt$L$$IEILHhI<$H5E bLɡ1LRG H57B AVfD1E1L 1L$ H5A AL_1LF H5A A@I<$蒶HL$(IEL)HL$ HfLl$HLd$0LF HD$8HHD$1ML$$Lt$ff.HAVAAUMATIUSHwHHuffD9.tL@H HsHtKuƒtDtMLD&t[]A\A]A^@Hvf.[1]A\A]A^1fU(SH^HHt6HnktHH[]@H{OHH[]DL 11L+# RH5@ AHH[]ff.fAUIATIUSHHnt3LGpHLHhH%u1҅uH<+Lm1҅H[]A\A]ff.@AWAVIAUIATIUSHxVdH%(HD$h1ƒtfL Ş111Lk@ qH5 ? AHL$hdH3 %(Hx[]A\A]A^A_@H^L~I9LHLItHL9uAT$t@@@I]I9u HL9tMD$HCI9uH,L{ L 1uMN`pMAP`@(H<H%ML9@(vV===L# LL}111H5= AEDw uI@M?LPHL|$`HD$M;Mvr ;L (\H^L~L9oLHLmHL9u`@ `uL;|$M9 2I@LLD$H8LD$A@ @D…%D1fL)1A11L ,H5< ADI?1@I@H0 `LT h!DI@MLxHLT$`HD$MlMG  h0L! f.IHL$` Z1L;|$tn E1HL$` L\$ILT$_LT$MN L\$1M92L;|$1M9!IHL$`  1L;|$E1HL$` L\$ILT$hLT$M L\$1M9I@HHD$@ƁL 111L H5: AqI@ALxD$`MwA8vn zZLl U t`M|L;T$1M9! `uf/w&f(#\f(fT f/f/_\ fTf/a1Zf.!fD1 1L;|$`HLL;xu0LHHauH\$l$ Lt$(Ld$8Ll$@HD$HHD$H9D$vH\$l$ Lt$(Ld$8Ll$@H|$LD$IOLD$LYHMHL$A@H1%@D$0Ht$ H9L|$Lt$HLd$PH\$8Hl$@Ll$XM@L9%HD$ E1HT$(AAH@HHD$QbDHT$(MHI݉fDHLH;ju%HD$H|$2HH0t`EDDAVII9s‰DLMHD$ HHD$ H9D$OH\$8l$@Lt$HLd$PLl$Xf/~w*f(~%\f(fTf/Jf(f/\fTT1L;|$H\$8l$@Lt$HLd$PLl$X=1L;|$1L;|$\ yfTa1f/1L;T$1L;T$f/V1f/f(\fT,1L;T$YLD$Ll$0H\$l$ A@Ld$(%@D$0YweA@%@D$0BDAVIAUIATIUHS袥Ht"HI9tUHLLL)$HCHuFL 11Ln , H5v/ A[1]A\A]A^HHCHLZ[]A\A]A^ff.AWAVAUATUSHG(€W(uH[]A\A]A^A_DHH?HÅ^H]@Le@L9{HE1HcHHD9LOL9uIL]IH L=/ U@K1LLLAsHcSH}LZ)HLWt{HL9C)uC,H1uHU`CH@HLL0E(uH}1LulL f1L H5- AHu0H}1蹡nrL 1Li H5- ADL 1L 1IH5[- AD(\IH@H}H50 #u?wL 1L H5, AL1N]H}H}跡LP11L7IHú}1H5, AH}H޻*L\DU1E1L 1L H5[, A_L Ћ1L 1dH52, A1hL 1L H5, Aff.fAWAVIAUATUHSHHHL%_1P,uLg`HHt HR:sDk(A LeAHHH@L-, 8_fI9sHLL)MAąhH;L2H;H5LeL" _H;HHuL1AąL hDxP(EwMc`8LxYHH1MEDH* LHoH;IcHY4Lj H;H5$LL5 /L 1H5) 1E1AHD[]A\A]A^A_fDH;L1˝AąxDk(1AAFHAYfD@H@HI|k^4Lz IHSHsH;1PAąL^ 9L 1H5") 1ALtYLT$ WT$ HHt IDIH;1ҋ@H@HIt賜H;H5藜sH;H5~{WH;H5_;IDk(La mL 1H5%( 1A*f.HHZH@8MH;H5Kߛ1L F1L H5' AHE1XLH;1H苛AąutL ?:fDL@VHH1MEDH( LHWlxsH;IcH%-Dk(Z@LhWH;H5@* GL AąDk(AI%fL1 L (1H5& 1AfL1 DL zWfH;H53: LL 1LL H5!& AhL) af.L  +L [H;H59 谙AąNL MXff.@AUIATUSHHH>uQ?DL% 1u(I]HH[]A\A]; tH;t1҉HL3tDt 8uQf8tDHuL j11L6& H5$ AH1[]A\A]I]HHC[]A\A]DHIE11L(LGIwNI:LAI9tt<_uIAAI9uHHtD@HL11Lq% jH5# A1HE1@AWIAVAUATUSHXT$AH|$dH%(HD$H1HD$ H$,u@IA,t LHEt<,uHL)H+PLD$@-H$1L%1I|$PHD$LE1Lh "DAFH<@IHLHPsH4$HLtDD$L$DH|$,IAHL$HdH3 %(HX[]A\A]A^A_DH-11H|$1ҾnLty11H5C" UH1AWAٹL H5" UX1ZkD$@IHsHH-h1L 1FH5! URIHsD$fDH-!11ɺK1LH5! UDHD$L``I|$PtgHH LhhE11HL$AFH@IHI|Pt9I|HT$H4$&tDD$L$1DH|$zIVH-y1@AWI1AVAUIHHATUSHHLD$H\$HdH%(HD$81H-31H}PMe HE1!@AFH<@IHHHPHLH\tHD$E7AHL$8dH3 %(DHH[]A\A]A^A_fDD$L111LH5 ADL$Im`H}Pt`Me E1Mmh1!fDAFH@IHH|PaI|LHAtHD$E7A1E1)TAWAVAUATUSHHH|$T$0dH%(H$1HD$\HD$HD$XHD$ HD$`HD$(<,uH<,tIf.IAt<,uLH)ILt$LD$HHHL$ L|$0T$\t$XPH vAFH\H}1 HL$ ЉALKH$dH3 %(HĘ[]A\A]A^A_@1H|$1ҾL%}111LujH5 A$Hk1SALV H5 A$X1ZefH5HRHuD$ID$4HD$HT$(L1LLppLl$(AUI!%tDIULDHD$(II)I~L$4H\$HLMHl$8IŃL|$@L$4@|$4t; L$H H{tXHkH,MLHLxILRuM9tK|=H5jQuIM9tH H{uHl$8L|$@H\$Ht$7L$0HD$tA|$ x@H|$1,HfDHt$HV` HP`E1HzPHDt$Ll$$fDAD$IH@HHHxPbD0t11DLHIU`Lt$Mn LKD$4IAFD$MEȉL$ Pf.AWAVAUI͹ATIH=z1UHSHHt$dH%(H$1HDŽ$HDŽ$=2=H|$HD$HHDŽ$HHDŽ$wIƄdKMHD$ HfHBu _t-u IAuM9GLH$LLL)L$L$>$$H@HID$`HD$0H$1LH=z1D$H$HZD$%D$HUHD$0DxD$fD$t AOAGAH$HD$@Au'H$AHDHD$@f.I$$AHL$(HD$XL$(HHD$8%I$D$HDŽ$0HDŽ$pH<"A<'9L$0A DT$PH$pLHD$(HHSHDT$PE#fD;2H HSHtAtL$0L$pD1M)HLſHtIH$0H$H$pH$Ag|$%A EljD$HD$(D |$H$H|$(LD$y$LD$HEH$D$L5w1HD$(H$HD$ uMt$`IL$@It$@H9uH H9t;Q,uAA9uH@HIDHD$D$#A(I$HL$8LD$0H8ԌLD$0HL$8HII$HL$8LD$0H8蟌LD$0HL$8HHIFHƨI$HT$HHL$8H8LD$0LHT$HLD$0HHL$8HBD$IAFL[uM[L$p t1I$DLL$pH0AӅL$pLD$(L+D$ D$IxLD$DLD$HH$p Ht$ LHLD$NLD$H$pBI$I^H8{HH$pEIFH8I$H8HHLsHuLfHuH$1L*)HH@H$ HH=t1 HuH$H=t1ݾ5MtHI}LH$dH3<%(HHĸ[]A\A]A^A_DAA1LyL-s111LtkH5B AUML`H5# 1AUAL 16H5 LL$AU71L. H5 AUHD$1HE fDHuL$H=Ps1L訽H$1HL'HHtHHu LH= s1dD H$HuUHr1HD$0@$AA1LL-r111LjH5 AUML*LAr1LMLA OH5 AMt+HI}LHLH$HI$H8IHupfDAI$LM1L-q1L H5 AUfLYq1LML _H5 AL$0L$pDM)uDA@@hA{ AH|$@H|$8 @"1ɀ'H$H$A HHD$(HH$H$H|$XH)gIH9HfDŽ$$H$H$H$H$$HD$ $IHDPH$pL HHD$PrCH$pI?-@HL)HJ!HU!Hb#LdHHHHHL'IHHIIAH HqI&H JcDH9R۸$DAlAD$D$fIHHHD$ HDPHt$PLǺ LD$8lBH$pLD$8H?:HL)HO"H#"H!HAdD$HHIHHIHA'IHIHHRI<H<3$D$${\$HHH"H|$ H1HDr@+@- HAHt$PHϺ HL$8aAH$pHL$8I?:HH)HHLdHHIH<IIiHkHc$@$<$DHHH ;t$<Lt$@1H|$ DD$ALL$09LL$0Lt$@IFHL9DD$LpHD$@LpEH|$XL}D|$AAD|$HD$(1E1H$$@ ($DP$8$81$0:$0$4:$4@AHD$81E1H$HD$(gAHD$8<"> <'6 11H|$8H$H$A $0KL$HD$(HHD$0L-,k1 L%LHH5 1AUHDŽ$L1ɺ$1H5` AU=fDA  H|$8H$H$蜴HD$8HHD$88% H|$@H|$8H$pH$01XHL$@HH A@H$pHD$8D |$AD|$HD$81E1H$HD$(HL-j1@H$HD$@6fD+([}{H$HxA H$HD$(HHD$(L$1E1HD$@H$ A@~4AADARAxA 1"'H$H$1HA HD$(HL$1E1H$HD$@XL-h1L 1HDŽ$H5 AUDI$xDLLD$訵LD$HH DH@HAA D$ADHL$8HyL-g1LL$1L. H51 AUL:1ɺ+1H5 AU>@Lg1LMLA VH5 A I$Ht$ LL\$(H83}L\$(HIH$p D$%@vn=O==L-f1LL$1L?H56 AUfDI$LH8yK uMFMHIIt ISI@HI$LH8dyr|$IL$AN_fD$%=D$IE1AFd$@]4fDI$LM1L-e1LH5  AUfDL-e1LL$1L H5 AUL-Ue1EKRM]HHGe1LHL<1 H5 A[L e11ɺ/1LH5j AHD$0 L-d1LLH1H53 AUL711H5 HDŽ$AUDH|$@p H|$X HDŽ$HDŽ$0EwIHH豻H\$8AGH$pHHL$PH==d1HH$舮_<" <' 1H|$8H$0H$A HD$8H5 H$0H$LH|$X- L-~c1L1ɺ_ H5 AUHD$0HXHD$8H|$XLH$MvIٹ L @n)dH|$@HD$@0I$HT$8HL$0H84yHT$8HL$0HHBL-b1LL$1L H5 AUEL-b1 KRHIT$`M]H(L  H LDHLRd 1H5 AA_LXLL$ 1H5x AU>I$L.L-a11L H54 AUH|$@qHD$@D$IAFID$`LHAL-ma1LL$1LR H5 AUHD$8L-+a1LL$1L8 H5 AUNHD$0 L-`1L9LHMIFIHISH@HH|$@ HD$@E1DI$HIFHɿ(1L-[`1LH5 AUIFMy LISH@HIVMIH"IKHBHIVM AiACHBVHƄ$0%A^HD$8Q=DHD$8xLPfH$\$(L$0LHD$ M蘩"1ɀ'Ht$ A LHHHZHT$P H=)_1HH~ H\$8\$(9 L ^1Mt';^1tH^1DH;XtLMuL-^11L2 H5AUHD$0HXH"AWSH$0H$LH|$X$H$p?IH\$0LT$1L-]1L H5YHIAULT$LT$8gfDI$LM1L-]1LhH5AUL-o]11LP H5AUHD$8H$HD$0HXL H LDHLbR` L-\1HL-\11Ly1ɺ H5WAUH|$XLoHD$0HXILZ A@[HD$@HJL-\1LL$1L  H5AUL-O\1LL$1L H5AUrL-\1 L*1H5}AUHD$0HX.H$H$HxHD$(HH$H$H|$XH)qIH]01 LH3HYHL$@HAHAL-P[11ɺ 1LH5AUL 1& H5AUHDŽ$L-Z11ɺ 1LuH5ZAUHD$8AGAu1DAGH$0H$LH|$X(l L-yZ111ɺ LH5AUHD$0HXH|$@o H|$@INHG?Ht HAHWHI$E1DW"81L-Y1LH5WAU"L-Y1LT1ɺ H52AUHD$0HXAGHD$8L$H$HD$@L8MH\$0[ L-\Y1LH5HIAUHD$0L-2Y1HL )LEHMUSA PLEʃ H5s1AHDŽ$_AXHD$0L-X1 LLHL-X11ɺ 1L3H5AU^LHWH)HXHD$ HDPHL)HDŽ$LDŽ$葢HHT$ LL$z-LL$1HLB2HT$ ;"2INff/f/BY<E1DI$,HHL-W1L$p1LH5AUHD$0L-jW1HL aLHA MUASLEP 2LD$ LL$v,LL$ 1HL.LD$ IHu ;" I^E1 DI$H#'L$pWLE1LɺI$DLL$LL$ 1L-xV1LaH5AUHT$ LL$+LL$1HLj0HT$ ;"UH|$@%HD$@INHHtfH*Y YE1DI$@D$D$L-U1LH5AUL-U11ɺ%1LH5AUF1LH5AU6+AuLdHHHLHHHJ 1L-T1LGH5MAUL)AHWI)HD$ HDPILHD$ HWHDPH)HAAE 1L-TT1LH5AUKL-6T1Lt HA+ 1L-S1L~H5kAUH.E1D$8uL-S1APt$L$LH51AUAYAZHt$PH$H$%H|$P[ $tH-T$8+$HL$@HH)I)HYLqL--S1L1ɺq ];"RH\$8ML-R1L1z HH5bSAUY^LH|$Xe HOHt$P LD$`HHL$88&HL$8LD$`H$pIHH)ȹII)Iڀ?-/JL)IHIAH  1L-(R1LiH5AU 1L-Q1LH5iAUHt$PH LD$ \%H$pLD$ HH$1L_Ht$P LT$pLHL$hLD$`L\$8%L\$8H$pILT$pLD$`HL)H)Iʀ?:HL$hJL)IpHe1D$HH$pHD$8AGv AGLIH?H7H<Ht$  Ht$ HHID$H HHI9uHH %L1Ll$ IHHHtLHA9wHLLl$ H!L-.P1H\$8z LH5AUHD$0HXH\$0HD$81L-O1L/t H5OHIAUg 1L-O1LH5AU 1L-{O1LH5AUr> 1L-NO1LwH5AUEHcHAdHIH+$@&INHЃfHH H*XL-N11ɺ31LIH5.AUCL-N1L 1L H5AUALdHHIIL_Ht$P 1LLD$pLL$hLT$`L\$8!L\$8LT$`HHLL$hH$pLD$ppHL)H)HLHL)dL-M1ASt$LL$I$HT$HHL$8H8LD$0cHT$HLD$0HHL$8HBD$3IAFL-OM1S t$LL$L_Ht$P LT$xLLL$pHL$hLD$`L\$8 L\$8LD$`HHHL$hH$pLL$pLT$xeHL)H)HLHL)| 1L-L1LH5 AUHȾdD$HHH1IHHID$H1E15 1L-2L1L[H5AU)HAHIH H\$8lH\$8L-K1 L1H5DAUHD$0HXZL-K1L L-K1L AVIAUIATI1UHSHdH%(HD$1H$iHHuHHH=JK1襕tQMtlHI|$菢H4$LHL}HHL$dH3 %(Hu_H[]A\A]A^f.MtHI|$L;fIH8|IHtLu1s AVAAUATIUHSHHdH%(HD$1HHsHtH;:]HHCAMtA<$tH5_rLu&HL$dH3 %(DH[]A\A]A^fHE1DpH8襩HHtHHLH,HH<$ړ8IHAHXrH?_IHHt(H=SZIEH L%I1H51LA$HHt H}[Lp1ɺ1H5LA$HHE1H8[DL H1L*1ɺH5AfL-yH11L%H5AU1MLZH5AU1LH5AUASHH?H2]HtHCHC [fVL G1LH5-A1[DHF IHHAHPHF IHHE1H3AUI ATUHSHH?Lc"]IL[HtgH}HZHHt=1DHH߾ ,x`LeIm I]H[]A\A]@LNL F11H5&AH1[]A\A]f.E1SLzF1LH5AH1[]A\A]HHQ0AUI ATUHSHH?D"|\fLHtgH}HXHHt=1DHH߾ t+x`DHEIm I]H[]A\A]ÐL1kL E11H5AH1[]A\A]f.E1pLZE1L H5AH1[]A\A]AUI ATUHSHH?Lc"l[LHtgH}HWHHt=1DHH߾ d*x`LeIm I]H[]A\A]@LL D11H5AH1[]A\A]f.E1LJD1L[H5AH1[]A\A]AUIATUHSHH?L"\ZL3HtgH}HVHHt=1LHH߾T)x`LeIm I]H[]A\A]@LL xC11H5AH1[]A\A]f.M1L:C1LH5AH1[]A\A]HwHtHW H9tfHw HG@( tHB1L|1ɺH5BL1AfSHHHtH8tTHHt裔H;[TH[RfAWAVMAUATEUHSHHxH$H|$HL$ H~H eS-HD$(H$dH%(HD$h1Ht&131H @0 H HxuH HyuʾHT$HT$HIHD$HtAGIWxADA G(Mw0Io`I_pAG(A tAYEt AG(tAG(IG@HHD$ΘIPŘAwIpxH8HtHPH8HHDIW (H=|9%RIH)IO`1ۀyHQpu T@HH`HszuHHSIGhH=HD$1LH5+L61ɺH51H\$hdH3%(L~Hx[]A\A]A^A_fL O>1LH5AfLE1uAG(EL >1L1ɺH5hALE1)E@L =1L 1H5+ALE1|1HPIGhH^L r=1L1H5AHt$ 1LY@L !=1L1H5AkDSHH?RHtH裃HC[\L <1LH5A1[D邃fAWIAVAUATUSH(dH%(HD$1H9HD$HLt$HD$Lo@<,uDH<,tHfHEt<,uII)HL$MLHLn~EHc1H-;1SLH5)UXL-Z11ɺnH5U1Ht$dH34%(ueH([]A\A]A^A_E1IG@L9t(L$T$ DHL9t9H,u9PuH(H1Lf*^dX`USH HHG*f* Yх~/w( \ʁ/wH[]H([]fD^ H([]ff.AVIAUATIUHSH?MhLUHIc$HHH}LIHA<$HLZLx HLL[]A\A]A^@H}HL{LCL d911H5A[1]A\A]A^HLH50[]A\A]A^H}H$LuL떐HtW1HtPH9tVH}fH*HxOfH*^Y*,t=D@f.f.HfHH H*XDHfHH H*XnfSHHHHtH[΋fD?HT$H4$UH4$HT$HHHuL 711L H5HAH1[ff.HHt1DAT1UHSHE@HM@H9tfPPHH9uH]PLePM(I9u[l@HpHt HSHHS8C0Ht'HBLExHHHu@H@HH61PPHL9tHHu벻[]A\@L 6111L<H5A[]A\ÐAVHE-IAUATIUSH\$8Hl$@t$Ht$8Hn61Y^IHtHt;uIDž[L]A\A]A^fDHHEHH6DAAt ApH HBHD AuËH@HLHtAtAuH51HHPAɺ 1L-H5XZ1LH5[L]A\A]A^IH5 _HtIH=Ht/HLMAE%A$L1VL 4111LQ,&H5AILAM(L[]A\A]A^DHq41L1 H5L A41Lʳ1ɺ-H5ALE1i@G( u%SHu H[C uH[2ff.HHP/HfAWAVAUATUSHH(HHt Hx?HkPHAą[C(HHt HP:uC( BLs@HC@H$I9AF)Av,L-31uLk`H;FC(0LkPI9ufMmI9I}ZIHtHPHpH2tVL越LHuHs0H;1FuL d21LH5AfDH;GH(D[]A\A]A^A_fDC(@uHxf.HAHtH0H蟊LsPHD$IHD$I9tAN0u I~8H;EHHt H@8@M~IFM/HD$L91IUML;l$tIIWB)ut/HH;Ht H@8Hs01ErIWIwH蚥C(@uL$M $IUL;l$uHH;HtLH@8uC1H55EH;L;t$t#1H5|YE!H;f.H5dDwH;EHE1IHK01HH$L(tL'H$HRDJ AHL11AWLpH5AXZC(@7Lt$II9HD$@DG EuH H@0HxwH;L-/1L91H5AUL1ɺ1H5E1AU DH`H;H2BIHHKPH9y1DDADzK H H9uLDH htCH[E|O,@IIuH虆IEM9uHHV^HoC(.71H5QWBtH;1H5%B3L'H;H5BH .1H;L(bCL1ɺIH5f1AM6L;4$fDLx8LH;HpI DIHLHǾ=HL--1H@(x t'L %1ɺ1LQH5AUM11L.H5AUML1ɺH51AUH;L@HkPH\fH#HL؄AFH;1H@HIt0AHs0H;1@L f,1LH5AH;1H52@M~IFHD$M/I96LkPI9#I}藄HMmI9u@0tjL-+1L1H55AU6LA,L +1H51AH;A2fH;HvHH0DL-A+1Lr1H5AU<L +1LH5vADH*111LaH5FLL1ɺH5*1`HH p1H'DL-q*1L1ɺH5AUfDLL 0*1H5E1ALrLYGL )1LH5MA|L )1L<H5!APL )1L H5A$LAAWAVAUATUSH(H4$H-HAHͅuHHuCLL )11H5yA1H([]A\A]A^A_fC)tH([]A\A]A^A_fDH;@?IHH{I\$C)ID$HHD$L{@HC@AD$0HD$L9Dl$MH;(>IHAE,AEL54(1 H=!L@IMIBH€uM|$8Mo HH=€rLLCxLH3HARP4H|$L9MmL;l$FDl$HHtqHpHthHT$HcuWAD$0IT$8Ht5HBLCxLHH3@H@HHI'1PPID$8H@@)tC(@DEH@s8H;HI=ID$(HNL &1LH58A~fHC IE Ls`MoH<$PHAULRIMAJHIB@ILLE&1H51A1HtAT$0UH;L$'9$LIfLf.AEH@HIDZf.L %1L1H5 ANAEL=H@HMLH{PL|C(tHfAD$0EYH(H[]A\A]A^A_mHtAD$0EE-ff.f1ɺGkATAH=US5HtW(HH:HHtwD L`HhL{@H:HHL3|H[]A\L A$111L9H5AH[]A\DL $1LJ1H5kAH15H[]A\DL #1L8H5-AHAUATIUH@SHHH9IHHhHtE(AE LHCH{I]Me8H9uHH9t HxuIE(Lz *uMMtIELHx8IE8HIUHB(ڃB(H[]A\A]fL "11ɺ~1L)H5ALzH{L5H1[]A\A]fIUHBHH9tHxHH9umH-("11LH5UL11sH5kUXfIEHt]P( ⿉P(fL !11LS[H5 AH1[]A\A]MIE(DH ELY!111ɺ*L L2H5AlIED@ Eu Hx 3uMt'IELHx.lAM0*IE(H- 1Hx(LUIUx DJ At=H1ɺGHIH5PLra1AIELUY^DH AHH1ɿH\L=aPH51AIE@ XZM3H-2 1LkH5UL1ɺ{1H5UnH-1Lz1ɺ@H5XUL;1CH54Aff.H>UHSHgHH,U1C0<H{8tEHSHL81H5L`B HDH1J H Q1AY^HC(Hx8tLHx(tEHSHL1L_H5OB HDH1J H wQ1AXZc0HvHCHtS HǀP(HC(Ht@ H}Hu1H[]fL A11LH5AH1[]fDAULoATIUSHHGH(I9u<]DHxHt*ÅL(ÅtRHUHL9t&HHx(u@ HUHL9ufA<$tdH[]A\A]L1ɺL [11H5ɽAH[]A\A]DL1ɺAD$ u I|$ -qL 111LuH5aAAl$ H[]A\A]ff.@USHHtH1H{@s.H[]f.7H@u!IHHHHOr@t*HHP@-uքtҀ-urHH@uHff.@AWAVAUATU1SHt~HIDnA;@ugH;@tZuIL;Et) HH L;HEtHBDz tAHEI9t;HA@uH[]A\A]A^A_D@HATIMUSuUMtPHLHtuH0I$HHHEHHH{[]A\ÐLqcL 11H5YA[1]A\I$HukL 1LiH5'A[1]A\fL%hff.fSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$'x'HcH9ںCHL$dH3 %(uH[øS/H.HxHH[HEff.AWAVIAUATUSHH8H|$H4$dH%(HD$(1uHHIŻHl$E1A4DLAGEILcL)IHAAoIFLIL$HLEHEA9sA-HD$L(AGHL$(dH3 %(u@H8[]A\A]A^A_fLHT$LHHt @ff.HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$(HL$dH3 %(uH[ff.Ht'H1f9HH9uf1ff.ftE1ɸ@"tHTt\uHTuHcHf.f.AVAUIATIUHSt"f.-HTuA$t&LH)f-HuMt AUHcHH)IHdUHƄ-DHNHF-uHV-HHHHUUH΄u-A $fDHP-u HH-HHIAL$A $HЄuMtZAMtQ_-AMHBHP-u HH-HHIAMAMHЄu[L]A\A]A^@MI)f.N-uVΉHAuDHLH@-A $ fH&HL1I1AULZ`ATH5 UAH JH?fAVIAUIATUHHSH0LI%MdHtkHHIL'HHtm;HqH HDSHMMPH H1XZ[H]A\A]A^DHLHZ &HHtH멐L1SMAUH51L1AY^ff.HHu'=D"t$LIHHVAtLA\u\HfDff. f.HHGPta\u"t\u߈WLGHOuCHHqt/IH\uAp@\t@"uIH@LOHE1E1u-VfD<:ulM:LLDHALOt+<\uG<:t<\t<@t\LDHfHtLHtL@<@uMtLfIʸ@fDUHHSH1HvHt H[]1HtDH[]ff.AUAATIUHSHH(dH%(HD$1HD$HtH}H HHDHunEtu5fA$3V2w#H ҹHcH>f{t1H|$dH3<%(4H([]A\A]fHt$HH9\$t1 HD$'D$HxLfH*\8fT 8f/vfH\$EHU'HHfHH H*XfHtHH]f(O8fT 78f/H@Hd @H@H@ff@nfDHYHI>fDHƤ~)@BfDfDA4$Dʚ;fDfH*Y f/s H,\H,H?D;X{NrAWHMAVAUAATAUHH51SHL$H\$0HDL$dH<%(H$x1HD$/HH!HNIƋD$MH8H1BHH(s 9HuH$89H$P9H$h9HH AH}ARsIDD$EDHfH*I91fL1҃HIǃwH9wL 1HRHD@HBt 1S@$HRHHL0MfI*^QLVLHf(XZH$xdH3<%(LHĈ[]A\A]A^A_HH1HxD8)Hu1HD8*HuMH8BIH fHHuHHt'HHD$1HT$H5JEAǃH-B11ɺn1L…H5-UL tH1SLH5UXZI$E1HT$dH3%(DH([]A\A]A^A_fH-1LB1ɺiH51UL :rfDHLHL$HI H)LHIF(HD$LpHcIF0HHIvIV(IVHIN MNH5o1_AXH-11ɺ1LtH5߱UL .H1SLNH5UYL^LDH-1L1ɺxH5vUL H-Y1L1ɺrfDH-91Lƒ1ɺuH5&UL BH*HAHHD$LD$H!L)LLD$HLD$HIF8bHIN1LH5_vH-1L 1ɺH5q1UL fM4$I^I;^VHcT$1ɍBHfDIv0<a@ƃH@pD$܅A9N  In8H5 HtH5HlHI^H-1L21ɺ =HHtHIV@H51V L H-O1|H-C1Ĺ1ɺH50UL WLDAWAVIAUATIUHSH(dH%(HD$1;HtnH5AHHHt7IHT$dH3%(H([]A\A]A^A_DH5HIHt<L a111ɺLH5LA1fDHD$HKHPHC(HSPHC`LK PHCXLCPHCPH5ūPHCHPHC@PHC8PHC0PHC P1HP HIHD$E12DHKhLIHAD9|${ LH=t LH=ݭHKhH4LHCxHtcLFIHtNHLIHt;DCpLDDD$ IHtDD$ HKx1LD9Cp1IXL0LH5AHLI1 LH=uHKh@ LH=uHKh@LH=ǬHKh]1HSpH5ԬL"HcCpLIHHLL)HHHH1LH55tHcuqH5NL1HtH57LHyI.1L0L֫H5 A\H4LOHHLIHHLkHH1H9DAUIATI UHSHHHHHLHHL@H531L#uI]H[]A\A]f.M1vL0LH5AHHH1[]A\A]@L 011ɺoLA|H5AH1[]A\A]DAVIAUATIUHSH odH%(HD$1)$HIHHHHM1H59LtZ1ML 0LMH5AHH1HT$dH3%(ukH []A\A]A^@<$-uBHCIL 011ɺL){H5A1fD11LHCifUfSHdH%(HD$1FF F0Ht^HH5HHt'K8HT$dH3%(H[]H5aHHtLXMHPIE1E1HXHH2 AAtDLHu1ɺIE1H0LTH5LtT1ɺ0H51HHL$(dH3 %(D=H8[]A\A]A^A_IH3H,$LD$HD$HD$ADžueL ^01ɺ81LSH5Amf.L )01ɺ-1LSH5ބE1A=fE1DHD$HHPLpHT$HT$HPHD$MAFMnAIFAID1IuLI1AM9uylf.ffHHt'tuHtHuf.ff.@9USHwSHHHu2fw3HHt!H[Hm ;Mt1H[]f uL u(L 01ɺ1L!RH5AH{GuHupHuH{CtHuH{2u1fAWEAVIAUIATUHDSHHHA9w!_HCEHDCHA9tQ;uA9w#DHEEHDEAHD9s }u1H[]A\A]A^A_rD9uEu,אEtHEHSEHESHEEHHAtu'EuEH{HuHE{HEu u uvI]I.gff.@AUATUSHLgHO L9A4$HI\$FfG1H_HHH芝HEHH[]A\A]fH_1GHHHJHEHH[]A\A]fwH_H[]A\A]fH_GHHHHE`H[]A\A]@HGHxHA|$^(1衜1LU L9 1A]ub5D-?HEHHAʃHHEEAыA A!ɅEDDI9N]Hs\uSHrtenDEAHDH9L 0L1H5AEH[]A\A]H}E1H]HHbA $HH5w}A1H[]A\DL'HLHH|L?iHEHRHsEHxHEHEHH辤HfDC+?*tV|XHIHDH;HHHhHL`H[]A\f.H;HHtNHhHH@@H;HHtHhHH@o@LI1ɺeL 011H5{AH[]A\LiI1ɺ|HLDLII1ɺ4ATUSHHHt{|tH[]A\fDHHIHt`H;HHtHhHL`H[]A\DL 901ɺ1LHH5*{1AfDL 011LzH5zAJAWAVAUATUHSH8dH%(HD$(1>fIH|HIHvHcHL>LH1ɺBHHCHHsLL~LG1ɺEHHCHL|$ Lt$H{HALL;u HC8Lt$HLL|$ IFHD$DHHhHD$H]HEIFoAoHANoP AV oX0A^0H@@IF@IGo A'ohAoop Aw ox0A0H@@IG@A$fHL$(dH3 %(HH8[]A\A]A^A_f.;LF1ɺ<HHCHtQH@L|F1ɺ1HHCHt)HsLLHHCHuLGF1ɺ4L 0H5x1ACHsH{E1LLJq;uUHC8uLHPHHSHPHPHSHPHCHPHHSHPHPHSHPHC@Lt$ HLL|$IFHD$XHH|HXHD$HEIGoAoHAOoP AW oX0A_0H@@IG@IFo A&ohAnop Av ox0A~0H@@IF@L i01ɺ1LDH5ZwA@AVI(AUATIUHSHdH%(HD$1mHH(HIcL`wHIEHtsMe LLd$MuLL}vHHu;@D$tRHLHD$HHuLWvL Z0H5[v1ALHNHL$dH3 %(Hu=H[]A\A]A^fDL 01ɺ}1LCH5v1AfUHHSHH踔HHHH[]sHGHtStKHLDHVHHHt;rvHHHuÐH@Ht H9uH@ ff.AWIAVIAUATIUSH_HHGIAnfDHX;(r HXHHuAfD(HEt A.HXIAAI(HuL 011ɺ[HLBH5vAH1[]A\A]A^A_@HXH@Hi4L` H[]A\A]A^A_Hff.@ATAUHShHHtD HhH[]A\ÐL 01ɺm1LiAH5uALvIrE1MI)H9t't'8u#tH8LuA L9utAIAtA1ICD ff.H9tw?ou6ILvI)fDtH:LuA L9ut??ou7H)LvfDtH8LuA H9u1tÐ11H HADøL+vfLuIeE1MI)@H9t+t+8u'@tH8LuA L9utAI AtA1KRADff.ATUHSH9tCIH51H0fD0HHHH PI9tHHDVu[1]A\1[HM]A\ff.fH9tBUHSHHʐHH fHH9tHDQ tH9źHDH[]1fDH9t6UHSHHzHH fHH9t HDQ uH[]HÐHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$ʎHD$dH3%(uH=ff.fAWIAVAUIATIUHSHL7L$LLL$rHt]HLHLAAńt'LHHEHD[]A\A]A^A_fDH$H|$H5r1H$H|$1E1H5q@H9tGLnPH5Oo11A_AXH$dH3 %(H[]A\A]A^DHT$P޿ωH$HD$L$LS H5?pLW'D$AD$AA1H1틄$L0H5\nLnP1AY^H0Hэ8*I1ɺPH8n1PLmH5n1AYAZDLYnL(011H5mA{H 0L Q8誊I1ɺPHjL-mP0ILη011LmH5]mADL$L$0L+$I HD$IH9H PLmLR011H5lAXZH$,o$o$ L$o$HD$@$4)D$)T$0LL$H)Lױ0H1HAULflH5"iAX1ZH[]@DKAQeLx0h1Lih(H5hAAY1AZ'tDL-0Q1RH5hLDkAY1^t.HLDG1DH‰ Љ1I9u@tV‰ ‰1Ѝ 1Љff.fAWAAVAUATUSHHG D#GGN,I]HtYAAHt$HMIHE Ht4D9cuD9suH|$HsLԆt%IHEE HuHL[]A\A]A^A_ÃEDAUIATAUI|$ SH6HHtHxLL菉DcHH[]A\A]ff.fATIU1SIT$ HLpLIDhHU #EHHIL[E]A\A]A^[1]A\A]A^DAUAATIUHHSHH>|Hu }ED@LHHt HHtH@H[]A\A]fAUAATIUHSHHH{Hs {ED@LHuHtH8HtHH{+H[]A\A]ff.@AWE1AVIAUIATUSHHHj{ALhfHS #CL$‰I$HD$Ht[9ku HT$HsLu AMMDIHHuMt#IHtH@H[]A\A]A^A_H1[]A\A]A^A_ff.@fAUIATE1UHSHfIU DHHtHHxHHuAE9esH[]A\A]f.SHtCH{ 1PH8vCHC [ÐHFHFHw OHtfHu ЃH9sff.HHtOV!ʃ9rHw Hu߉ЃH9sDHH?@H?tHGH>HFHGH0HwPH c$H5cH=cvff.@HHtHH~HpH7PH c3H5DcH=UcevDHHGHBHff.fUHHSHHHHH[]'1H9?1H9~f1H9>SH1҅uHH[DSH1҅uHSH[@SH1҅uHSH[@SH1҅uHH[DH1H9tfHH9u@ff.@USHH?tnH>HtFHHtH[]ÐHCHUHH(HHPHUHHCHEH[]H aH5aH=atH aH5raH=atATDbUSA9tp)HHLH֍qHHLHH<Dz1rEHUHEHDHH)r1H4 9r[]A\fDutEt1fDEDDHH9t[L`8wLIc L>LHEEt4DE8YpHyE8\9)HA9wH@HxL/wHHHH9uÐLHA tDE:YDQIHyE8\9HL9uLHHH)EYL9iEt5>A8yWES1|HA:| 4I9uLLM@H@H<>LHHAL9HID9f.HHID fDHHID 11ff.AUATUHSHP_HwIHcH>L&I\$IHL9t_Ct{HHu1H[]A\A]ÐHt/LE1DHHL8HpetAD;+rH[]A\A]HEHHH[1]1A\A]fDL&11HI $UkA|$It$ H6>HfHE13LctDHHL8HpAD;+rFfDH 3LcE1DHHL8HplAD;+rfDAWAVAUATUHH]SHHcH>Ht7LcE1DHHL8HpAA9rՃwHHlPHHHHD[EguH[]A\A]A^A_@L6E1I^MDAHL9w{tHHu1H[]A\A]A^A_H6>HH_,1H_H;nH H=_&yH1[]A\A]A^A_DHt;LcE1DHHL8HpX_AA9rՃHHDTEdPHHHTHDJE?ufL.E1E1AEMuIRfDIHAHHI I 8HpAEII9'A/w9rH,(H=t\Hw1 DEH[]A\A]A^A_H6E~H5DH,ѾH]H81l1fH,H=[H`w1fHQ, H=[H0w1VfAD9Amt+11ۉLHIHP0A;]rLXm[]A\A]A^I]M1HS3LHnI9uHGHtH LHGIuHtH IUAuL.Lhl[]A\A]A^IUAu Ll[]A\A]A^AmJ11ۉLHIDHP0A;]rAm11ۉLHIDHP0A;]r1ff.fAWAVAUATIUSHH(H9t%HHRWHcH>tjLD$qH1Ht$oLD$HSLZA$H([]A\A]A^A_fH)IͅLCA$H([]A\A]A^A_ULnHHATHUHItttAEz9LCafHvH(H[]HA\A]A^A_fLnE}EAU8UIII)E9EBEAQH@HCAt@8tu HAH9uDLD$HHL$H)DL$9pDL$HL$HILD$E)ItHxLD$DxDHL$DL$mAoeDL$HTLD$HL$LLA&AEMuEM5LD$iD$LnAEOHHUItmtIAMuHAt AUDLnAEHHUIt%u1fLnAE0HHUItAUMAT AU\DLFNDAϿLD$IwnI1MLD$EnI~LAHMFqLsA$LD$HL$7nHL$LD$HIfo W1@@@$@4@D@T@d@t1AtAD6AoTHAHHuEHUILADZD$LvgD$LsfLD$HL$'mHL$LD$HIAEHUIvXLAFAoeEAfAomAn(Aou(Av8Ao}8AFA~HD$CLfD$LsLD$HL$wlHL$LD$HI11HpIUHMfLnEtEA/vfD1H[]A\A]A^A_'uH^HGH3HtH oCHEaH[]A\A]A^A_LfHSHIt'wHATuA<$WA$0wHUHLD$D$HUHLD$HMeHSLlDHHAtAUD9AUHUHLD$D$lfHMeHSLLDHA|AUD9wstQAUn1E11E1fDHE1H=KL5Kd3t(BL#L1HIYD9#wHE1H=KsdDl$ At&DDHAHHDHP0D;#rH[]A\A]A^A_HE1H=JL5JdIIt*B|#/wDLH1I2YIuֺHH=NJchDl$ E11ADHPHtHDHAHHTD;#rH[]A\A]A^A_fHE1H= JLccML=I@AIAAEtDLH1.X@HHH[H@I]1A\A]A^A_XH H2IH1WDsH[AD$ EL*H E1H=HLk@bDKEt0DHAALHH1mWD;srHH=HaD3H[cfHE1H=HL5HaDEt&DBL#L1HIVD9#wHE1H=HsaDl$ ;A"DDHAHHDHP0D;#rH[]A\A]A^A_HHH=G aDl$ A IL9A4$tIT$DHH DH5fFH=GVf.AWAVAUATUHSH6H9$HHaDHcH>HMeHSLtyDHELEuAUD9AUDH[]A\A]A^A_@LeHHAttHHSIt7H1[]A\A]A^A_fDLmEtEA/wAMHSHLtDHHA|SIAD0IU /w A8s HH9uAUDLD$mAEPAUHUHLJD$LeHIt$?E\$EI$ELD$HUVD$@LeII)ET$E9EBEt6AD$8_Aq1THA:TAUHUHLD$7D$j1E11E1I}DD$AUDLAUD$LD$lTED$I}DD$VAUDLBAUD$@UH(SHHRHt@HhHX H[]DSHWHw H[SfATIUHSHHfMHHH[]A\QSHHHwHHu[Ã+[ff.SHHwHHdH %(HL$1LD$HHD$5D$t)HL$dH3 %(uH[XUHHSH1H9t []t!uH@HHEf.H@HE뽐UHHSHHG8H9tMt H[]@L@H)A;Xst,AH8 uDK1fDAtH@:4 uI9uHHHp[]SHwHHdH%(HD$1HT$D$t DD$D9uHL$dH3 %(u,H[DH,HB?H81N1Vf.HHWw1HHHactivate/activate.c%s-%s-missing_%u_0No host tag matches %stpoolvpoolrealGetting driver versionGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists.kvdodm-%s (no device driver)Logical volume %s in use.idleCounted %d open LVs in VG %s.Found active component LV %s.UnmonitoredMonitored%s %s for events [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s (reverting) pool only thin only if activeSkipping: Resuming %s%s%s.Resuming LV %s%s%s%s.resumed temporary noscanSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active. origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvssuspendinglv_list alloc failed.failed suspendSkipping: Deactivating %s.deactivatingdeactivatedFound active holder LV %s.locking for suspendunlocking on resumeunlocking on revert%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/volume_list configuration setting not defined: Checking only host tags for %s.module string allocation failedsnap_seg module string allocation failedactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionmodule_present module name too long: %sInternal error: Target present version called when activation is disabled.Cannot determine activation status of %s%s.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking transient status for LV %s.Checking snapshot percent for LV %s.Checking mirror percent for LV %s.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid device count for LV %s/%sChecking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Unable to send message to an inactive logical volume.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.No degraded or partial activation for raid with integrity.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of LV %s containing an unrecognised segment.Refusing activation of RAID LV %s with visible SubLVs.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Not activating %s since it does not pass activation filter.LV %s has open %d snapshot(s), not deactivating.Failed to remove temporary SubLVs from %sDeactivated volume is still %s present.Releasing activation in critical section.Activation of logical volume %s is prohibited while logical volume %s is active.Cannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.cache/lvmcache.clvmcache %s: now in VG %s %sNo size for %s./dev/mdnot chosenis inis not inis nothashas nois used foris not used forof previous preferencedevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerDestroy lvmcache content#orphans_lvm2PV %s size is zero.Found PVID %s on %sAdding pvid to hash failed %sdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filtereddevice cannot be useddevice is a duplicatedevice not found_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: vginfo_lookup vgid %s has two names %s %sInternal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.device_list element allocation faileddelete dev from unused duplicates %sdelete dev from initial duplicates %sInternal error: lvmcache_get_bad_mdas no vginfo %sInternal error: lvmcache_get_mdas no vginfo %slvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %slvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.Fix duplicate VG names with vgrename uuid, a device filter, or system IDs.lvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sIgnoring lvmcache info for dev %s because dev %s was requested for PVID %s.No lvmcache info for checking bad metadata on %svgnameid_list allocation failed.vgnameid_list member allocation failed.extra md component check skip %llu %llu device_hint %s dev %sextra md component check %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %sSame wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: device_id %s. %s is %s. %s is %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s was prev %s. %s was prev %s.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.PV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.Internal error: PV %s with duplicates no alternate list entry for %sIgnoring md component %s with PVID %s (dropping info)Checking for multipath components for duplicate PVID %sVG info not dropped before rescan of %sVG info not found after rescan of %sInternal error: NULL vgname handed to cacheFailed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.Internal error: vginfos list should be emptyInternal error: lvmcache_update_vg %s no vginfoSee vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %slvmcache_update_vg %s for info %slvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %sWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sPV %s is a different format (seqno %s)lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: lvmcache_get_outdated_mdas no vginfodevice is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateInternal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.origin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0String list allocation failed for writecache module.Failed to allocate memory for writecache segtypewritecache/writecache.cwritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agewritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"Initialised segtype: %sintegrity/integrity.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lluUnknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.String list allocation failed for integrity module.Integrity target version older than minimum 1.6.0Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeFailed to allocate memory for integrity segtype Setting %scache_segtype/cache.ccache_modepolicy_settingschunk_size = %ucache_mode = "%s" Chunk size %s Metadata format %u Mode %s Policy %sCache supports %s.%s: %s failed: %sFound kernel symbol%s.fcloseSMQLVM-cache_pool_corigmetadata_startmetadata_lenmetadata_idcache_pool = "%s"cleaner = 1metadata_format = %umetadata_start = %lumetadata_len = %lumetadata_id = "%s"metadata = "%s"cache-poolmigration_thresholdsequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustment and aliases cache-mqCouldn't read cache chunk_size in segment %s of logical volume %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Internal error: Incorrect policy_settings tree, %s.String list allocation failed for cache module.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsuported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.Internal error: LV %s is using unknown cache metadada format %u.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Failed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtype/proc/kallsymsglobal/cache_disabled_featurescacheInternal error: _destroy_config: cmd config tree not destroyed fullyInternal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %s_init_profiles: dm_strncpy failed_init_hostname: dm_pool_strdup failed_init_hostname: dm_pool_strdup kernel_vsn failed_set_tag: str_list_add %s failedInternal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheWARNING: Metadata changes will NOT be backed upInternal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dInvalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failedWARNING: Empty system ID supplied.WARNING: Failed to allocate system ID.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Ignoring extra line(s) in system ID file %s.aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%Unrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Device directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationDM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.Internal error: connections must be initialized before filtersFailed to create internal device filterFailed to create global regex device filterFailed to create regex device filterFailed to create lvm type filterFailed to create deviceid device filterFailed to create usabled device filterFailed to create partitioned device filterFailed to create signature device filterFailed to create persistent device filter.Duplicate segment type %s: unloading shared library %sLVM_SYSTEM_DIR environment variable is too long.Internal error: Unprocessed pending delete for %d devices.Failed to allocate command contextFailed to allocate line buffer.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedcommands/toolcontext.cfilelinemessageprofile_params alloc failed_init_hostname%s%s%s failed: %sunameSetting host tag: %sFailed to create config tree/dev/archive_init failed.backup_init failed.debug_file_fieldsdebug_output_fieldsLogging initialised at %shost_listhost_filterhost_filter not supported yet%s/lvm%s%s.conflocalhostWARNING: %s: fopen failed: %sdeHImMSuUVwWycCxXyYSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s./dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idLVM_ configuration invalid./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETLVM_SYSTEM_DIRLVM_RUN_BY_DMEVENTDReloading config filessetlocale failedsetvbufD,!@T"@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@Internal error: _cfg_def_make_path: supplied buffer too small for %s/%sCouldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.Internal error: Profile %s already added as %s type, but requested type is %s.Failed to create default empty array for %s._get_def_array_values: strdup failedFailed to create default config array value for %s.Failed to duplicate token for default array value of %s.Internal error: Default array value malformed for "%s", value: "%s", token: "%s".Internal error: inconsistent state reached in _check_value_differs_from_defaultFailed to create default config setting node.Failed to create default config setting node value.Internal error: _add_def_node: unknown type_log_array_value_used: failed to write node value%s not found in config: defaulting to %s_config_array_line: dm_pool_strdup failed_get_config_node_version: couldn't create version string%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. Persistent cache directory name too long.WARNING: Configuration setting %s is disabled. Using default value.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.Failed to allocate config source.Failed to allocate config file.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sFailed to allocate configuration check handle.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.Internal error: %s cfg tree element not declared as boolean.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundFailed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.Internal error: add_profile: incorrect configuration source, expected %s or %s but %s requested%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeInternal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.Internal error: %s cfg tree element not declared as float.Failed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.WARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are lised in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Scan LVM LVs for layered PVs, allowing LVs to be used as PVs. When 1, LVM will detect PVs layered on LVs, and caution must be taken to avoid a host accessing a layered VG that may not belong to it, e.g. from a guest image. This generally requires excluding the LVs with device filters. Also, when this setting is enabled, every LVM command will scan every active LV on the system (unless filtered), which can cause performance problems on systems with many active LVs. When this setting is 0, LVM will not detect or use PVs that exist on LVs, and will not allow a PV to be created on an LV. The LVs are ignored using a built in device filter that identifies and excludes LVs. Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximumm is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less then the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Enables or disables whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. Deprecated option to set default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the write policy: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the emptry header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. For more information about selection criteria in general, see lvm(8) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metdata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Activate LVs based on system-generated device events. When a PV appears on the system, a system-generated uevent triggers the lvm2-pvscan service which runs the pvscan --cache -aay command. If the new PV completes a VG, pvscan autoactivates LVs in the VG. When event_activation is disabled, the lvm2-activation services are generated and run at fixed points during system startup. These services run vgchange -aay to autoactivate LVs in VGs that happen to be present at that point in time. See the --setautoactivation option or the auto_activation_volume_list setting to configure autoactivation for specific VGs or LVs. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename, version4 # Example vdo_disabled_features = [ "online_rename", "version4" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID (appmachineid is recommended.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Memory size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps perfomed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps perfomed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronising or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, radid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over log/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Show headings for columns on report. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as adecimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The lvmlockd sanlock host_id. This must be unique among all hosts, and must be between 1 and 2000. Applicable only if LVM is compiled with lockd support <#config/config.cSetting %s to %soption%s# Configuration %s %s. %s# %s%s#%s%s string float integer boolean section array with values of type: - %s%s%s%s%s%s%s # Failed to duplicate filename.%s is not a regular file%s is emptyreadconfig_tree allocation failedLoading config file: %sFailed to load config file %sstdoutDumping configuration to %sFailure while writing to %scommand profilemetadata profileUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cache(root)How LVM uses block devices. shellHost tag settings. abort_on_errorsprofile_dir#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfilesystem.devicessearch_for_devnames#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogoverwritelevelindentcommand_namesactivate_filedebug_classesbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasksi_unit_consistencyfallback_to_lvm1format_librariessegment_libraries/procLocation of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_default@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activationuse_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendlvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_check_optionsthin_repair_options#Sthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_check_optionscache_repair_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colslist_item_separator,columns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagssystem_idextra_system_idshost_idundefinedmerged filesspecial purpose1111011101111111x0111111111111111H0EEEEE\EDDD4datastruct/btree.cstr_list allocation faileddatastruct/str_list.cstr_list_to_str: string allocation failed.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.WARNING: %s failed: %s.device/bcache.cmisaligned data bufferio_destroyunable to allocate sync_ioio_geteventsio_setup failed %dsome blocks are still lockedCannot extend bcache fd tableLimit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldWARNING: async io still in flight.Device seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingbcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)_SC_PAGESIZE returns negative value.couldn't create control block setWARNING: _SC_PAGESIZE returns negative value.bcache must have at least one cache blockbcache must have a non zero block sizebcache block size must be a multiple of page sizeconcurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zerobcache_invalidate: block (%d, %llu) still heldInternal error: Cannot change not opened DI with FD:%dDrop alias for %d:%d %s.device/dev-cache.cdisk/lstatfilename strdup failed%s: New preferred namefgets%sdev/block/%d:%d/dm/uuidIgnoring %s: %s.Ignoring %s: Not a directory.dir_list allocation failedNo devno %d:%d in dev cache.dev_iter allocation failed/dev/nvmeFound nvme device %sFound dev %d:%d %s - new.Dir path %s is too longPath %s/%s is too long.%s: Not available device node%sdev/block/%d:%d/holders/opendir%sblock/%s/devclosedir%sdev/blockFailed to udev_enumerate_new.not found in configdev_cachestrdup dev_dir failed.preferred device name matcherNot a block device %s.Failed to get device %s%s/devices/dmeventd.devicesFailed to copy devices path%s/devicesCreating %s.Failed to create %s %d%s/devices/%sDevices file not found: %spvcreatevgcreateCannot access device %s.Invaild device type %s.%s: failed to allocate device list for device cache index.%s: failed to insert device list to device cache index.struct device allocation failedstruct dm_str_list allocation failed_get_sysfs_value: %s: no value%d:%d: dm_snprintf failed for path to sysfs dm directory.Drop alias for %d:%d invalid path %s %d:%d.Failed to add allias to dev cache.Couldn't add name to hash in dev cache.Found dev %d:%d %s - exists. %.8sCouldn't insert device into binary tree.Found dev %d:%d %s - new alias.Found dev %d:%d %s - existing device, path was previously %d:%d.Found dev %d:%d %s - new device, path was previously %d:%d.Found dev %d:%d %s - failed to use.%s: Symbolic link to directory%s: Different filesystem in directory_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.dev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberCreating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyDevice '%s' has been left open (%d remaining references).Internal error: %d device(s) were left open and have been closed.Couldn't create binary tree for dev-cache.Couldn't create binary tree for sysfs-only devices in dev cache.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.Ignoring dev with no valid paths for %s.Device path %s is invalid for %d:%d %s.Dropping aliases for device entry %d:%d %s for new device %d:%d %s.Dropping aliases for %d:%d before adding new path %s.dev_cache_get filter deferred %sdev_cache_get filter excludes %sget device by iter defer filter %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathFailed to lock the devices file to create.Failed to lock the devices file.Failed to read the devices file.Devices file not found, ignoring.Failed to lock the devices file to read.part%sdev/block/%d:%d/%sdevice/device_id.c%s/D_%s/run/lvm/searched_devnamesunlink %s errno %dunlink %sCRYPT-device/serialmpath-md/uuidloop/backing_filesys_wwidsys_serialdevnamempath_uuidcrypt_uuidlvmlv_uuidmd_uuidloop_fileQEMU HARDDISK(deleted)No idtype %s for %s/dev/mapper/Match device_id %s %s to %s/dev/dm-device_ids_read already donedevice_ids_read %sSYSTEMIDread devices file systemid %sVERSIONread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTmissing deviceDevice not added.Device not found for %s.Creating devices file %s%s_neww+SYSTEMID=%s VERSION=%u.%u.%uWrote devices file %sDevices file update skipped.Drop incorrectly matched %sSearch for PVID %s.stat %s errno %dSearch for PVIDs filtering.usablempathfwraidFailed to create sysfs path for %sWARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dMatch device_id %s %s to %s: ignoring idname %sMatch device_id %s %s to %s: using other dm name, ignoring %sMatch device_id %s %s to %s: dm namesCannot open devices file to read.WARNING: devices file has unmatching system id %s vs local %s.WARNING: failed to process devices file entry.WARNING: cannot open devices file to read.check devices file version %s prev %sWARNING: ignoring unknown device_id type %s.WARNING: ignoring device_id name %s.WARNING: ignoring deviceidtype %s which is not available for device.Missing support for DRBD idtypedevice_id_add %s pvid %s matches entry %p dev %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.WARNING: devices to use does not include %scompare devices file entries to devicesdevices idname %s previously matched %sdevices entry %s %s devname found but not matchedDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Devices file %s %s PVID %s not found.Cannot create devices file, missing devices directory %s.device_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Cannot open tmp devices_file to write.# LVM uses devices listed in this file. # Created by LVM command %s pid %d at %sIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s Failed to replace devices file errno %dWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %ddevice_id update %s pvid %s vgid %s to %sSkip devices file update (busy).Skip devices file update (changed).validating devices file entriesDevices file %s is excluded: %s.Device %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Device %s has updated name (devices file %s)du for pvid %s unexpected idname %s mismatch dev %sDevices file PVID %s not found on device %s (device PVID %s).Devices file PVID %s not found on device %s.device ids validate checked %d update disabled.device ids validate checked %d trying to update devices file.device ids validate checked %d found no update is needed.Search for PVIDs skipped for %sSearch for PVIDs reading labels on %d devs.WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Devices file PVID %s found on %s.Search for PVIDs other_pvid %d no_pvid %d other_idtype %d.Devices file PVID %s updating IDNAME to %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatesdevice/dev-ext.cUdev database has incomplete information about device %s.%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detached%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].device/dev-io.cClosed %s O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%s (test mode - suppressed)%s: size is %lu sectors%s: read_ahead is %u sectorsAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedCannot open device %d:%d with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Discarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sWARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.device/dev-md.c%s/dev/block/%d:%d/md/%sdm_snprintf md %s failed%s/block/md%d/md/%sdm_snprintf old md %s failedIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_memberDevice %s %s is %lu bytes.Device %s %s is %s.raid%draid_disksDevice %s %s is %d.metadata_version1.00.90Found md ddf magic at %llu wrong crc %x disk %x %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sInternal error: dev_is_md_component_native requires io layer.Found md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.Device %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.@@@A@A0A0A A@A@A@A@Ignoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %smultipath config ignored %d wwidsSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %d:%d.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentmpath hash table creation failed.multipath wwids file disabled.dev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileSysfs path to check mpath components is too long.Failed to create sysfs wwid path for %sdevice/dev-mpath.cdevice/vpd_pg83blacklist_exceptionsblacklistmultipath wwid %s in %s %s/etc/multipath.conf/etc/multipath/conf.d/etc/multipath/conf.d/%snot %sdev/block/%d:%dreadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dir%sblock/%s/dm/uuidmpath pool creation failed.naa.eui.t10.unknown wwid type %smpath_memberDM_MULTIPATH_DEVICE_PATH%s/dev/block/%d:%d/slavesDevice %s has no slaves dir%s/block/%s/device/wwidscsi_debugdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPEND%s/dev/block/%d:%d/partitiondevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.Failed to read %s.Failed to parse %s '%s'.%s/dev/block/%d:%d/%sblkextdrbddasdemcpowerVxDMPlooppower2device-mapperNVMEDMDRBDDASDEMCPOWERPOWER2VXDMPBLKEXTLOOP%sdev/block/%d:%d/partitionID_PART_TABLE_TYPEDEVTYPE%s/dev/block/%d:%d%s/block/%s/devsysfs file %s does not exist.Device %s: %s is %lu%s.BLOCK_SIZELVM2_memberLVM1_memberDM_snapshot_cowSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELsoftware RAID md superblockswap signatureLUKS signaturealignment_offsetqueue/minimum_io_sizequeue/optimal_io_sizequeue/discard_max_bytesqueue/discard_granularityqueue/rotationalqueue/daxSCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic MultipathingWARNING: %s: partition path is too long.Fatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: %sdev/block/%d:%d/loop/partscanSysfs path for partscan is too long.WARNING: sysfs path for %s attribute is too long.Sysfs dm uuid path for %s is too long.Failed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sInternal error: dev_is_partitioned_native requires i/o.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %sWARNING: sysfs file %s not in expected format: %sWARNING: Device %s: %s is %lu and is unexpectedly less than sector.Found blkid BLOCK_SIZE %u for fs on %sNo blkid BLOCK_SIZE for fs on %sFailed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)SUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)Wiping %s signature on %s.device/dev-luks.cLUKSdevice/dev-dasd.cioctl BIODASDINFO2t10.%seui.%snaa.%scling_by_tagsnext freedisplay/display.cclvm%.2fPercentage %d does not fit.--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREENEW (exported)(but full)--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %uPV UUID %sNOT PV Name %s Total PE / Free PE %u / %uread/writeread onlyINACTIVE (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%LV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %dMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %sr/wName is zero length.WARNING: Invalid input '%s'.[n] Accepted input: [%c]PVSUnrecognised allocation policy %sFull LV name "%s/%s" is too long.%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPV Status %sallocatable%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dread/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sLV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversionVG Access %s%s%s%sVG Status %s%sresizable%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]Name cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.vvvvvԦ$tnoyescontiguouscclinglcling_by_tagstnormalnanywhereainheritierror/errseg.cerroerror module string list allocation failedimporting unknown segmentunknown/unknown.cstart_extentFailed to allocate name.Failed to allocate memory for unknown segtypeInternal error: Destroying composite filter while in use %u times.Composite filters allocation failed.filters/filter-composite.ccompositeComposite filter initialised.Internal error: Destroying persistent filter while in use %u times.%d:%d: filter cache skipping (no name)%s: filter cache skipping (cached bad)%s: filter cache using (cached good)Failed to hash alias to filter.Allocation of persistent filter failed.Couldn't create hash table for persistent filter.Allocation of device filter for persistent filter failed.Persistent filter initialised.filters/filter-persistent.cgoodbadfilter cache deferred %sfilter caching %s %sInternal error: Destroying regex filter while in use %u times.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.Filter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filters/filter-regex.c%s: Skipping (regex)filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.Internal error: Destroying sysfs filter while in use %u times.filter-sysfs disabled: /sys/dev/block not foundNo proc filesystem found: skipping sysfs filterfilters/filter-sysfs.cfailed to create sysfs path%s: Skipping (sysfs)Sysfs filter initialised.Internal error: Destroying md filter while in use %u times.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detectionfilters/filter-md.cfilter md deferred %smd filter allocation failedMD filter initialised.Internal error: Destroying firmware RAID filter while in use %u times.%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]Firmware RAID filter allocation failedFirmware RAID filter initialised.filters/filter-fwraid.cInternal error: Destroying mpath filter while in use %u times.%s: Skipping mpath component deviceNo proc filesystem found: skipping multipath filtermpath filter allocation failedfilters/filter-mpath.cmpath filter initialised.Internal error: Destroying partitioned filter while in use %u times.filter partitioned deferred %s%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]Partitioned filter allocation failedPartitioned filter initialised.filters/filter-partitioned.cInternal error: Destroying lvm_type filter while in use %u times.%s: Skipping: Unrecognised LVM device type %luLVM type filter allocation failedfilters/filter-type.cLVM type filter initialised.Internal error: Destroying usable device filter while in use %u times.%s: Skipping: dev_get_size failedUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).filters/filter-usable.c%s: Skipping unusable device.%s: Skipping: %sToo small to hold a PVInternal error: Destroying internal filter while in use %u times.%s: Skipping for internal filtering.filters/filter-internal.cinternalInternal filter initialised.Internal error: Destroying signature filter while in use %u times.%s: Skipping: error in signature detectionfilters/filter-signature.c%s: Skipping lvm1 device%s: Skipping gfs-pool devicefilter signature deferred %ssignature filter initialised.Internal error: Destroying deviceid filter while in use %u times.deviceid filter allocation failedfilters/filter-deviceid.c%s: Skipping (deviceid)deviceiddeviceid filter initialised.format_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %s%s/%s_%05u-%d.vgArchive file name too long.Expiring archive %sunlinkArchive rename failed for %sNo archives found in %s.Archive file %s not found.Created path %s/%s is too long.Couldn't create text instance object.Couldn't scan the archive directory (%s).Couldn't create new archive file.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more then %u MiB in %u files (check archiving is needed in lvm.conf).Internal error: Passed file path name %s is too long.*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.Zeroing start of device %s%s not wiped: abortingTest mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Couldn't copy archive directory name.Couldn't copy backup directory name.Failed to generate backup filename (for removal).Couldn't create text format object.Failed to setup physical volume "%s".Failed to allocate PV list item for "%s".Set up physical volume for "%s" with %lu available sectors.Failed to allocate format instance.Deleting existing metadata for VG %s.Removal of existing metadata for VG %s failed.Failed to duplicate empty name.Failed to find cached info for PV %s.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Failed to wipe existing label on %sConsider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: problem tracking indentationDoubling metadata output buffer to %u# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"Could not allocate memory for string list buffer.Internal error: PV name for uuid %s missing from text metadata export hash table.pv device name size is out of bounds.Could not allocate memory for ancestor list buffer.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.text_export buffer allocation failedCould not format metadata for VG %s.Error parsing metadata for VG %s.format_text/export.cuname failed: %sBuffer reallocation failed.MegabytesKilobytes# %g %s# Hint only%s = %lustatus = %sflags = %s2.03.14(2)-RHEL8 (2021-10-20)version = %ddescription = "%s"creation_time = %lu # %s%s = %s%s {creation_timecreation_host = "%s"lock_args = "%s"allocation_policy = "%s"profile = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %usegment%u {start_extent = %uextent_count = %ureshape_count = %utype = "%s%s"physical_volumes {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %luseqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"extent_size = %umax_lv = %umax_pv = %umetadata_copies = %utext pv_namespv%dhistorical_logical_volumes {removal_timeorigin = "%s%s"descendants = %s%ss = ["%s", %u%s"%s", "%s"%sGigabytesTerabytesPetabytesExabytes?@P?Internal error: Unknown flag set requested.Internal error: Metadata inconsistency: Not all flags successfully exported.Cannot duplicate segment string.WARNING: Unrecognised flag %s in segment type %s.format_text/flags.cStatus value is not a string.CACHE_VOLUnknown status flag '%s'.PARTIAL+%sREADWRITEWRITE_LOCKEDFIXED_MINORVISIBLEPVMOVENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPNOAUTOACTIVATEERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLALLOCATABLEEXPORTEDMISSINGRESIZEABLECLUSTEREDSHAREDformat_text/format-text.cUnlinking %sRenaming %s to %s%s: rename to %s failed: %sTest mode: Skipping renameFailed to read VG %s from %sRead volume group %s from %smda_context allocation failed LVM2 x[5A%r0N*>fdopenWriting %s metadata to %sfsyncpe_startMDA1 startdisk sizeMDA0 endlabel scan sizepe_endba_endPV %s missing from cache%s.tmp(ignored)(used)empty preWrite from %s.Write[%u] from %s.VG %s metadata writing failedFailed to read vg %s from %sVG %s not found on %sWARNING: No cache info for %sFailed to allocate dir_listtext_orphanInitialised format: %sTest mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.'%s' does not contain volume group '%s'.PV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %llu%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.Reading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Internal error: can't remove metadata area with index %u from PV %s. Metadata layou not supported by %s format.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Creating metadata area on %s at sector %lu size %lu sectorsInternal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %llustruct metadata_area allocation failedstruct mda_context allocation failedNot enough space available for metadata area with index %u on PV %s.Failed to move metadata area with index 1 while resizing PV %s.PV %s too large for extent size %s.Random lvid creation failed for %s/%s.PV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedCouldn't allocate text_fid_context.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.struct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Failed to write metadata area headerVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sWARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sWARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.Internal error: read_metadata_location_summary called with NULL pointer for mda_headerMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.Found metadata summary on %s at %llu size %llu for VG %sFailed to allocate text format type structure.Couldn't create text label handler.Couldn't register text label handler.Failed to read outdated pv mda header on %sFailed to write outdated pv mda header on %s LVM2 x[5A%r0N*>format_text/import.cReading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.There are %d physical volumes missing.descriptionCould not find status flags.format_text/import_vsn1.cCould not read status flags.Could not read flags.Couldn't find section '%s'.Importing logical volume %s.creation_hostcontentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find uuid.Invalid uuid.Empty pv section.dev_sizeEmpty logical volume section.Empty segment section.reshape_countSegment allocation failed_mimagetmpsegment_countmax_lvmax_pvmetadata_copiesphysical_volumeshistorical_logical_volumesread_vgCouldn't read pv summariesUnknown historical logical volume %s/%s%sCouldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sFailed to allocate list item for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Found an item that is not a stringEmpty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read status flags for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device hint in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device_id_type in read_pv.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Cannot duplicate segtype string.Couldn't read segtype for logical volume %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.Couldn't create pv hash table.Couldn't create lv hash table.Unrecognised format %s for volume group %s.Couldn't read uuid for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Couldn't find volume group in file.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Failed to allocate memory for device hint in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device_id_type in read_pv_sum.Bad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Zero areas not allowed for segment %sCouldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.s, mda2 ( mda1 ( da1 (format_text/text_label.c ba1 (Retrying metadata scan.Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Internal error: %s label header currently requires a data area.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luWARNING: bad metadata text on %s in mda%dFound pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.WARNING: scanning %s mda1 failed to read metadata summary.struct data_area_list allocation failedstruct mda_list allocation failedCouldn't allocate labeller object.freeseg/freeseg.cFailed to set up async io, using sync io.Failed to set up io layer with %d blocks.scan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedDevice open %s has DEV_IN_BCACHE already setDevice open %s already open with di %d fd %dDevice open %d:%d has no path names.Can't open %s exclusively. Mounted filesystem?Drop alias for %d:%d failed open %s (%d)Invalid path %s for device %d:%d, trying different path.Scanning %d devices for VG infoProcessing data from device %s %d:%d di %dClear pvid and info for filtered dev %sIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringFound label at sector %llu on %sClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dCouldn't allocate memory for labeller list object.Checking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.Enable full md component check.Filtering devices to scan (nodata)Will scan %d remaining devicesWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBCannot reopen rw device %d:%d with no valid paths di %d fd %d.Cannot reopen rw device %d:%d with no valid name di %d fd %d.Reopen writeable %s uncached fd %d di %dFailed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Failed to change to rw fd %s di %d fd %d.reopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dError opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.Scanning failed to get devices.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.dev_set_bytes bcache not set up %sError writing device value %s at %llu length %u.Scanning for labels to wipe from %sFailed to read label from %s sector %llu%s: Wiping label at sector %lluFailed to remove label from %s at sector %llulabel/label.cFailed to set up sync io.close %s errno %drwexrwFailed to set bcache fd.open %s %s di %d fd %dScan failed to open %d:%d %s.Scanning submitted %d readsScan failed to read %s.%s: No lvm label detectedScan failed to process %slabel allocaction failedFinding devices to scanFailed to set up devices.Failed to get device list.close and reopen excl %sclose and reopen rw %sdev_read bcache not set up %sFiltering devices to scanReading labels for pvidclose and reopen to write %sFailed to open device %sFailed to write label to %s/run/lvm/hintslabel/hints.cunlock_hints no existing fdunlock_hints flock errno %dlock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %s/run/lvm/newhintsnewhints created/run/lvm/nohintstouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %sReading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclear_hint_filepvscan_recreate_hints_beginget_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entries# Created empty by %s pid %d %signore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Invalid hint device %d:%d %s pvid %s had vgname %s no PV info.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dget_hints: applied using %d other %d vgname %s#global%s/P_%slocking/file_locking.c%s/V_%sToo long locking filename %s/P_%s.Too long locking filename %s/V_%s.Path for locking_dir %s is invalid.locking/locking.cglobal flock already held exFailed to activate %sLVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking initialisation failed.File locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.Internal error: Unknown locking mode %s.%H:%M:%S.%06ld LVM_SUPPRESS_SYSLOGfailed to write log file: %s failed to write log file DM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=650CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %sstderrdup2dup2(%d, %d) returned %dLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINESLVM_EXPECTED_EXIT_STATUSMESSAGE=lvm command %sCODE_LINE=882PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sfatalnoticecmdlabelprocessingvsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).File descriptor %d already open in read-only mode, expected write-only or read-write mode.Can't set standard input for log output.Failed to open stream for file descriptor %d.Failed to allocate buffer for stream on file descriptor %d.Internal error: reopen_standard_stream called on non-standard streamWARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".%d %*s %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluWARNING: Cannot parse content of %s.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".MESSAGE_ID=3ca432788c374e4ba684b834188eca36Ignoring unrecognized journal value.log_command_vprint_log/proc/self/statsmqmetadata/cache_manip.cUnknown cache mode: %s.another LVCan't convert internal LV %s.Setting chunk size to %s.%s_cpoolFlushing of %s aborted.Use cache metadata format 2.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cache mode is not determined.Internal error: Cannot set cache mode for non cache volume %s.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Cannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Size of %s data volume cannot be smaller than chunk size %s.Preferred pool metadata size %s.Can't prepare new cachepool name for %s.WARNING: Skippping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Failed to sync local devices when clearing cache volume %s.Failed to sync local devices after final clearing of cache %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Detected default cache metadata format: %u.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Replacing chunk size %s in cache pool %s with chunk size %s from profile.Internal error: Failed to wipe cache pool for volume %s.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.%s=%smetadata/writecache_manip.c%s=%llureporter_poollvol%dflush_on_suspendRemoving previous wcorig %sFailed to deactivate %s.Failed to update VG.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s has no suffix for cachevol (skipping rename).Failed to generate new unique name for unused LV %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.Failed to activate LV %s for flushing writecache.Failed to sync local devices before detaching writecache.Failed to flush writecache for %s.Failed to deactivate LV %s for detaching writecache.Failed to set writecache cleaner for %s.Failed to create list of writecache settings.metadata/integrity_manip.cbitmapJ%s_imetalvconvertcrc32cLV update and reload failedFailed to add integrity.lvcreateLV %s segment has no integrity metadata device.LV %s integrity segment has no originextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sLV %s segment is unsupported raid for integrity.Failed to update and reload LV after integrity remove.Failed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Failed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")Integrity can only be added to top level raid LV.Integrity cannot be added to snapshot origins.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to build list of PVs for %s.Failed to create metadata LV name.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVFailed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroFailed to activate LV to check block size %sIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Path name too long to get LV block size %sCannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Failed to deactivate LV after checking block size %sAdding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sunassignedmetadata/lv.c:%u-%u(%u)nopassdownnot monitored%s is %son %slvfullname snprintf faileddm_pool_alloc failedlvpath snprintf faileddm_build_dm_name failedlv_dmpath snprintf failed%s/%s%sreshapeFailed to duplicate hostnameActivating logical volume %s.Thin volume %s is active._format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvseggs: extent range dm_snprintf failed_format_pvsegs: extent number dm_snprintf failed_format_pvsegs: list item dm_pool_zalloc failed_format_pvsegs: list item dmsnprintf failed_format_pvsegs: failed to add item to listInternal error: Bad pvmove structureCannot query non thin-pool segment of LV %s for discards property.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.WARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.modules str_list allocation failedInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentInternal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.Failed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.QPXQxQPQQQPFailed to allocate memorymetadata/lv_manip.c %s/%s uses %shistorical Failed to create new nameCannot rename locked LV %s--dry-run--verbose--yes--force merging origin clustered and DISCARD with %u snapshots(s) with snapshot %s (origin only)ConsideringChanging with PV tags: pv_list allocation failedraid0raid4raid5raid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_ncmultithinoriginthinsnapshotmultiextthinoriginwritecacheoriginintegrityoriginmultithickoriginthicksnapshotpublicStack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata areaup to contiguous dm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areasphysicallogicalat most Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.Invalid stripe size %s.Can't resize reshaping LV %s.Live by historical LVCreating logical volume %sLV %s in VG %s is now hidden.Historical lFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.WARNING: Failed to unlock %s.cache originexternal originVDO poolHistorical Layer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypelv_list alloc failedCan't move snapshot segment.Removing layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %s_mimage_0Inserting %s:%u-%u of %s/%sInterrupted initialization ofFailed to wipe signatures onFailed to initializeInterrupted initialization%s logical volume %s.BLKZEROOUTioctlNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %srimage%s_%s_%u%s_%s%s_rmeta_%uFailed to insert layer for %sReducExtend and openlv_info failed: aborting.Filesystem check failed.Filesystem resize failed.Failed to activate %s.%s: discarding failed.Problem deactivating %s.snapshot exception storestart of new LVAdding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.Aborting. Failed to wipe %s.%s_voriginCouldn't create snapshot.vpool%dthin-poolvdo-poolLogical volume "%s" created.Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"Couldn't create LV path for %s.Couldn't generate new LV size string.Do you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listPV tags string extension failed.Not using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.Memory reallocation for parallel areas failed.PV tags string allocation failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.WARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Failed to find segment for %s extent %uLV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Couldn't allocate new %s segment.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedallocation handle allocation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Parallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.alloced_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Generating list of PVs that %s/%s uses:Rounding size to boundary between physical extents: %s.Reducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremention size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Ignoring stripes, stripesize and mirrors arguments when reducing.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Failed to allocate generic logical volume structure.Failed to allocate generic logical volume list item.Failed to allocate generic volume list item for indirect glv %sInternal error: %s logical volume %s is not a user of %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list Removing historical connection between %s and %s.Unable to allocate logical volume structureFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.parallel_areas allocation failedLV %s in VG %s is now visible.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.Failed to detach writecache from %sIgnoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Detach cachevol before removing.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"%sogical volume "%s" successfully removed.Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Remove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Internal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Failed to find segment for %s extent %u.Failed to split segment at %s extent %u.Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.Failed to generate unique name for unused logical volume.Incompatible layer boundary: %s:%u[%u] on %s:%u.layer segment for %s:%u not found.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Inserting layer %s for segments of %s on %sMatched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uVolume %s is not active locally (volume_list activation filter?).Failed to sync local devices before wiping volume %s.Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.%s logical volume %s at position %lu and size %lu.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate localy %s for wiping.Failed to sync local device names after deactivation of wiped volumes.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.Adding segment of type %s to LV %s.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Insufficient suitable allocatable extents for logical volume %sUnable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.%sing logical volume %s to %s%sSize of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Policy-based resize is supported only for snapshot, thin pool and vdo pool volumes.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set bellow minimal supported value 50%%.Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.--poolmetadatasize can be used only with thin pools.--poolmetadatasize for thin-pool metadata cannot be used with size.Internal error: No single component user of logical volume %s.Cannot resize inactive VDO logical volume %s.Cannot resize inactive VDO POOL volume %s.Cannot resize external origin logical volume %s.Cannot resize a RAID %s directlyCannot resize logical volume %s while it is tracking a split image.Cannot resize %s LV %s. Convert to more stripes first.RAID module does not support shrinking.Can't resize internal logical volume %s.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Varied stripesize not supported. Ignoring.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Ignoring --resizefs as volume %s does not have a filesystem.Varied striping not supported. Ignoring.Mirrors not supported. Ignoring.Cannot resize logical volume %s with active component LV(s).Cannot reduce LV with integrity.Also going to resize thin-pool metadata to match bigger data.Ignoring PVs on command line when reducing.Logical volume %s must be activated before resizing filesystem.Logical volume %s must be activated before reducing device size.WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Cannot resize %s without using device-mapper kernel driver.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Logical volume %s successfully resized.Failed to sync local devices before deactivating LV %s.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wipping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)Internal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.WARNING: New %s won't be synchronised. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Cannot use writable LV as the external origin.Cannot use active LV for the external origin.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).Test mode: Skipping activation, zeroing and signature wiping.Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Failed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Failed to sync local devices before creating snapshot using %s.Zero segment type for virtual origin not foundVirtual origin name is too long.Failed to activate sparce volume %s.Aborting. Manual intervention required.Failed to sync local devices before reverting %s.Unable to deactivate failed new LV %s. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Failed to resume thin snapshot origin %s.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.Ī <_tdata_cdata_corig_wcorig_vdata_tdata_cdata_corig_wcorig_vdataLV %s invalid: %s for %s segmentLV %s invalid: %s (is %u) for %s segmentmin recovery larger than max recoveryLV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %uLV %s: segment %u has same LV %s for both origin and snapshotLV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imageLV %s invalid: maximum supported areas %u (is %u) for %s segmentDataLV without RAID image flagMetaLV without RAID metadata flagdata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingis not referencing VDO pool LVLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %u uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %uLV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s: inconsistent LE count %u != %uLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u linksLV %s is indirectly used by historical LV %sbut that historical LV does not point back to LV %sLV %s is indirectly used by LV %sbut that LV does not point back to LV %sLV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LVLV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin cant't be writable.LV segment %s:%u-%u is incorrectly listed as being used by LV %sSegment with extent %u in LV %s not foundUnable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentmetadata/merge.cnon power of 2 region sizemirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2zero area countzero areasextents_copied too largenon-zero origin LVnon-zero cow LVnon-zero origin_listno DataLVDataLV size variationsno MetaLVMetaLV size variationsno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratenon-zero stripe sizeminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindbogus RAID segment typeno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVis missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets invalid VDO parameter(s)sets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_privateLV %s: has no segment._cmetametadata/metadata.csnprintf random bit failed.Skipping clustered VG %s.Failed to add tag %s to %s/%s2.4.#orphansvg_remove_mdas %s failed%s: Couldn't get size.Volume group %s is read-onlyformat_instanceAdding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.pv allocation failedvg_createFailed to hash mda.SettingClearingignoredin-useFailed to allocate pvid hash.Failed to hash pvid.Failed to allocate uuid hashFailed to hash lvname.Failed to hash lvid.Failed to write VG %s.LV %s dev %s is pmem.LV %s dev %s not pmem.LV %s on pmemnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundRescanning devices for %s %sVolume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkReading VG %s %sInternal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sFailed to allocate pv structure.Allowing forced access to clustered vg %sUsing metadata size 960 KiB for non-standard page size %d.Requested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsAdjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to mininum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.New volume group name "%s" is invalid.%s: already exists in filesystemNew volume group path exceeds maximum length of %d!Old and new volume group names must differvg->name allocation failed for '%s'pv->vg_name allocation failed for '%s'Marking PV %s as moved to VG %sPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.Logical volume %s/%s does not support tagsFailed to duplicate tag %s from %s/%sVolume group %s does not support tagsFailed to duplicate tag %s from %sFailed to add tag %s to volume group %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Specified size is smaller then physical extent boundary.No free extents in the list of physical volumes.No free extents in Volume group %s.Converted %s%%%s into 0 extents.Converted %s%%%s into %u extents.Internal error: Read ahead data missing.Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Calculated readahead of LV %s is %uVolume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?Format does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedFailed to clear metadata from physical volume "%s" after removal from "%s"Attempt to modify a read-only VGVolume group %s is not resizeable.Couldn't allocate format_instance object.Adding physical volume '%s' to volume group '%s'pv_list allocation for '%s' failedPhysical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).PV %s cannot be added to VG %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.pv_list allocation in pv_create failedFormat-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sPhysical volume %s not in volume group %sLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Failed to read existing physical volume '%s'WARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Adjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sMetadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Marking metadata areas on physical volume "%s" as %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uInternal error: LV %s (UUID %s) not found in committed metadata.Internal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sFailed to allocate lv_name hashInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Failed to allocate lv_lock_args hashInternal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s/%s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s/%s shouldn't have lock_argsInternal error: LV %s/%s with no lock_type has lock_args %sInternal error: LV %s/%s appearing in VG's historical list is not a historical LVInternal error: Historical LV %s points to different VG %s while it is listed in VG %sInternal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sInternal error: Duplicate historical LV id %s detected for %s in %sInternal error: Duplicate historical LV name %s detected in %sFailed to hash historical LV nameFailed to hash historical LV idInternal error: Name %s appears as live and historical LV at the same time in VG %sInternal error: Historical LV %s is not part of any LV chain in VG %sCannot allocate lock for new LV.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!WARNING: wiping mda on outdated PV %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Failed to destroy record about historical LV %s/%s.Outdated record for historical logical volume "%s" automatically destroyed.Invalid mix of cache device types in %s.WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Found a previously MISSING PV %s with no MDAs.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.Volume group name "%s" has invalid characters.WARNING: activating multiple VGs with the same name is dangerous and may fail.Rescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.Rescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan for text offset mismatch - now %llu prev %llu.Rescan skipped - unchanged offset %llu checksum %x.Ignoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.VG %s not found on any remaining devices.vg_read %s ignore mda for outdated dev %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.WARNING: failed to strip outdated historical lvs.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.Cannot change VG %s with unknown segments in it!WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %p4:pv->devto_go <= pva->countAllowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sconsume_pv_area_create_mapsmetadata/raid_manip.cFailed to allocate new name.rmetaMemory allocation failed.%s_%s_%%draid0_metaraid10_near (same as %s%s)recoverExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Failed to add sublv %s.LV %s in not partial.%s has enough space for %s.Failed to add %s to %s.%s_iorigFailed to get device count.Failed to get device health._extractedraid5_nFailed to resume %s.Post callout function failed._mlog__mimage__rmeta__rimage_%s called on non-raid1 LV._rimage_0Adding %s to %s.Adjust data LVs of %s.Data LV renamed to %s.Can't convert %s LV %s to %s.Adding metadata LVs to %s.Can't convert %s to %s. losing %s resilienceRemoving mirror log %s.Failed to remove mirror log.Setting new segtype for %s.Renaming %s to %s.raid1 with reducingenhancingLogical volume %s NOT split. to %s typeRea--stripes-I/--stripesize-R/--regionsize? [y/n]: dm_snprintf failed.LV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Internal error: bogus reshape space reallocation request [%d]Logical volume %s is already of requested type %s.Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Extracting image components %s and %s from %s.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisable by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.No proper new segment length for %s!Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Cannot restripe LV %s from %u to %u stripes during conversion.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Internal error: Bogus reshape space allocation request.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: LVs must be set visible before removing.Failed to sync local devices after removing %u LVs in VG %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Failed to prevent PVs holding image components from LV %s being used for allocation.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.%s must be active to perform this operation.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.Internal error: Bad type provided to %s.Extracting image component %s from %s.Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s.LV %s has to be of type raid4 or raid5_n to allow for this conversion.Unable to convert %s while it is not in-sync.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Logical volume %s NOT converted to "%s".Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Adjusting region_size from %s to %s for %s.Adjusting region size of %s LV from %s to %s.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.Failed to allocate string for new LV name.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Allocation of new areas failed.Allocation of new meta areas failed.Failed to clear REBUILD flag for %s components.%s is out-of-sync! Please try refreshing first.Are you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: No segment for %s.Failed to retrieve raid0 segments from %s.Cannot convert striped LV %s with varying stripe count to raid0.Cannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Failed to allocate new raid0 segment for LV %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Updating VG metadata and reloading %s LV %s.Reordering areas for raid0 -> raid10_near takeover.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.Failed to allocate meta areas memory.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Splitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Unable to split additional image from %s while tracking changes for %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to find image to satisfy request.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.Converting %s LV %s to 2 stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %sCan't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Failed to adjust LV %s to new size!Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Minimum 3 stripes required for %s LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Integrity must be removed before degraded or partial activation of raid._extract_image_component_error_seg_raid_reshape_remove_images_raid_reshapemetadata/segtype.cWARNING: Unrecognised segment type %sInternal error: Unrecognised segment type flag 0x%016lxmetadata/snapshot_manip.csnapshot%dlocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesraid with integritySnapshot volume cannot be smaller than 3 chunks (%u extents, %s).Internal error: Cannot get origin from snapshot %s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Failed to sync local devices before deactivating origin LV %s.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Internal error: data_lv_from_thin_pool arg not thin pool %sInternal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsitent external origin.Internal error: LV %s is not pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: pool_is_active called with non-pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Segment in %s is not a thin pool segment., perhaps skipped in lvm.conf volume_list?Internal error: Updated LV %s is not pool.Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Failed to sync local devices LV %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Internal error: Unknown discards type encountered.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more then %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).metadata/thin_manip.cAdded %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupLV %s has no segment.Cannot find free device_id.Found free pool device_id %u.performanceCropping metadata size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.Failed to build device path for VDO formating of data volume %s.Slab size %s converted to %u bits.Internal error: Unable to find configuration for vdoformat command options.Invalid string in config file: global/vdoformat_options.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Using bigger VDO virtual size unaligned on extent size by %s.Internal error: Unrecognized compression state: %u.Internal error: Unrecognized index state: %u.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized VDO write policy: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedRounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formating of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formated VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Sysinfo free:%lu bufferram:%lu sharedram:%lu freehigh:%lu unit:%u.Failing to parse value from %s. %s RAM for physical volume size %s%s %s RAM for virtual volume size %s%s %s RAM for block map cache size %s%sNot enough free memory for VDO target. %s RAM is required, but only %s RAM is available.VDO requires %s RAM, currently available %s RAM.metadata/vdo_manip.c--logical-size=%luK--slab-bits=%u--uds-memory-size=%u--uds-memory-size=0.%u--uds-sparseCommand %s failed.%s/block/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtoolofflineclosedopeningclosingrecoveringnormalasyncasync-unsafestatistics/data_blocks_usedSkiping VDO formating %s._vdataUnknown VDO write policy %s.AnonPagesMemAvailableMemFreeMemTotalShmemSwapFree/proc/meminfoParsed %s = %lu KiB. %s RAM for index memoryVDO configuration needs%s. andĥԥNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Internal error: global memory pool used for VG %sFailed to allocate VG hostname hashtable.Failed to allocate volume group structureSetting mda_copies to %u for VG %sPhysical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Failed to allocate memory for system_id in vg_set_system_id.Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Removing "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedRemoved "%s" from volume group "%s"metadata/vg.cFreeing VG %s at %p.Failed to allocate VG name.Allocated VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255vg_set_lock_type %s no memInternal error: VG is NULL.No device found for PV.vgreduce_single VG %s PV %sMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.mirror string list allocation failedstruct mirr_state allocation failedMissing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't read 'mirror_count' for segment '%s'.mirror/mirrored.cFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.extents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %u Mirrors %u Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations:mirror_count0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-misc/lvm-exec.cExecuting:%sforkexecvpChild %u exited abnormally%s failed: %upipePiping:%s/dev/nullpipe[0]STDOUTpipe[1]STDINwaitpidInternal error: Missing command.Failed to sync local device names before forking.wait4 child process %u failed: %smisc/lvm-file.cgethostname%s/.lvm_%s_%d_%d%s: rename to %s failedsync_dir failed in strdupF_WRLCKF_RDLCKLocking %s (%s, %hd)fcntlUnlocking fd %d%s: write errorNot enough space to build temporary file string.fcntl_lock_file failed in strdup._undo_flock %smisc/lvm-flock.cUnlocking %sflock_drop_shared_flock %s._do_flock %s %c%cGiving up waiting for lock.Unrecognised lock type: %dLocking %s %c%c convertLocking %s %c%cFailed to convert flock on %s %dTEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.LVM activation checks disabledmisc/lvm-globals.c%s[%d]LVM udev checking enabledLVM udev checking disabledLVM activation checks enabled[unknown]misc/lvm-signal.csigprocmasksigactionSIG_SETMASKInterrupted..._block_signalssigfillsetSIGINTSIGTERMNames starting "%s" are reserved. Please choose a different LV name.Names including "%s" are reserved. Please choose a different LV name.Failed to build LVM dlid for %s.Internal error: Name is too long.misc/lvm-string.c_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_voriginpvmovesnapshotUdev library context not set.misc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandom/run/cmirrord.pidFailed to create udev library context.WARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sLock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dRaised task priority %d -> %d.WARNING: setpriority %d failed: %s.Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dInternal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Entering critical section (%s).Entering prioritized section (%s).Leaving critical section (%s).Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dmm/memlock.c[vectors][vdso][vsyscall]locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesLocking memory%s/self/mapsproc_dir too longgetpriorityUnlocking memoryLeaving section (%s).memlock reset./LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libaio.so./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libedit.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./etc/selinuxFailed to connect to dbus: %dnotify/lvmnotify.ccom.redhat.lvmdbus1Nofify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %sorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %dD-Bus notification failedFunction not implementedproperties/prop_common.cInvalid property name %sProperty name %s does not match type %dUnable to set read-only property %sshrinkingrebuild+emptymetareshapingraid/raid.cRaid transient status %s.raid0_lvsstripe_sizeNo areas found for segment %sraid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %u Raid Data LV%2d Raid Metadata LV%2d %sdevice_countstripe_countTarget raid does not support %s.Active raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Missing data device in areas array for segment %s.Failed to import RAID component pairs.raid module string list allocation failedCouldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.Failed to allocate memory for %s segtyperaid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6report/properties.clv_full_namelv_pathlv_dm_pathlv_parentlv_layoutlv_rolelv_initial_image_synclv_image_syncedlv_merginglv_convertinglv_allocation_policylv_allocation_lockedlv_fixed_minorlv_skip_activationlv_autoactivationlv_when_fulllv_activelv_active_locallylv_active_remotelylv_active_exclusivelylv_majorlv_minorlv_read_aheadlv_sizelv_metadata_sizeseg_countorigin_uuidorigin_sizelv_ancestorslv_full_ancestorslv_descendantslv_full_descendantsraid_mismatch_countraid_sync_actionraid_write_behindraid_min_recovery_rateraid_max_recovery_rateintegritymismatchesmove_pvmove_pv_uuidconvert_lvconvert_lv_uuidmirror_log_uuidmetadata_lvmetadata_lv_uuidpool_lvpool_lv_uuidlv_tagslv_profilelv_lockargslv_timelv_time_removedlv_hostlv_moduleslv_historicallv_kernel_majorlv_kernel_minorlv_kernel_read_aheadlv_permissionslv_suspendedlv_live_tablelv_inactive_tablelv_device_opensnap_percentmetadata_percentcopy_percentsync_percentcache_used_blockscache_dirty_blockscache_read_hitscache_read_missescache_write_hitscache_write_misseskernel_cache_settingskernel_cache_policykernel_metadata_formatlv_health_statuskernel_discardslv_check_neededlv_merge_failedlv_snapshot_invalidvdo_operating_modevdo_compression_statevdo_index_statevdo_used_sizevdo_saving_percentwritecache_total_blockswritecache_free_blockswritecache_writeback_blockswritecache_errorlv_attrpv_fmtpv_majorpv_minorpv_mda_freepv_mda_sizepv_ext_vsnpv_sizepv_freepv_usedpv_attrpv_allocatablepv_exportedpv_missingpv_pe_countpv_pe_alloc_countpv_tagspv_mda_countpv_mda_used_countpv_ba_startpv_ba_sizepv_in_usepv_duplicatepv_device_idpv_device_id_typevg_fmtvg_uuidvg_attrvg_permissionsvg_extendablevg_exportedvg_autoactivationvg_partialvg_allocation_policyvg_clusteredvg_sharedvg_sizevg_freevg_sysidvg_systemidvg_lock_typevg_lock_argsvg_extent_sizevg_extent_countvg_free_countvg_missing_pv_countlv_countsnap_countvg_seqnovg_tagsvg_profilevg_mda_countvg_mda_used_countvg_mda_freevg_mda_sizevg_mda_copiesdata_stripesreshape_lenreshape_len_lenew_data_offsetparity_chunksthin_countthin_idseg_start_peseg_size_peseg_tagsseg_pe_rangesseg_le_rangesseg_metadata_le_rangesmetadata_devicesseg_monitorvdo_compressionvdo_deduplicationvdo_block_map_cache_sizevdo_block_map_era_lengthvdo_index_memory_sizevdo_slab_sizevdo_header_sizepvseg_sizereport/report.cdm_pool_strdup failedrefresh neededmismatches existout_of_datalvname snprintf failedagotime_now@%ld:@%ldskip activationqueue_dup_Failed to get segtype name.Failed to allocate buffer.lvm2_Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.Description of Device Type.Unique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Device Typesdevtype_vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Command Logqueue when fullqueue if no spaceerror when fullerror if no spaceread-only-overridero-overrider-overridewriteableread-writecheck neededinactive table presentinactive tableinactivelive table presentlive tablelivesnapshot invalidmerge failedactive exclusivelyactive remotelyactive locallyfixed minorfixedallocation lockedimage syncedinitial image syncunmanagedundeftodayyesterdaySundaySunMondayMonTuesdayTueWednesdayWedThursdayThuFridayFriSaturdaySatnoonmidnightsecondsecminutehourhrAMPMweekmonthyearyrJanuaryJanFebruaryFebMarchMarAprilAprMayJuneJunJulyJulAugustAugSeptemberSepOctoberOctNovemberNovDecemberDecFailed to allocate buffer for mode.alloc_time_item: dm_pool_zalloc failed_get_glv_str: dm_snprintf failed_get_now: dm_pool_zalloc failed_get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Failed to allocate buffer for host.Failed to allocate buffer for time.Failed to allocate buffer for active.Failed to display role for LV %s/%s.Failed to display layout for LV %s/%s.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronisation log.For mirrors, the UUID of the LV holding the synchronisation log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Use REQ_SYNC for writes (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can recieve (vdopool).Specified write policy (vdopool).Header size at front of vdopool.Physical Extent number of start of segment.Logical Volume Device Info and Status CombinedReserved value for undefined numeric value.DDDDCDC\DDDCD'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):)unknownyesno10snapshot/snapshot.csnapshot-mergemerging_storecow_storesnapshot-origincow_store = "%s"merging_store = "%s"Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.snapshot string list allocation failedTarget snapshot may leak metadata.striped/striped.c Stripes %u Stripe size %s Stripe size %u KB Stripe %d:# linearstripeInternal error: striped add_target_line called with no areas for %s.Couldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'. Device ID %uthin/thin.cthin_pool Discards %s Thin count %u Transaction ID %lu Zero new blocks %sThin pool delete %u.Thin pool create_%s %s.thin_pool = "%s"transaction_id = %ludevice_id = %dexternal_origin = "%s"merge = "%s"discards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %ddiscards_non_power_2metadata_resizeexternal_origin_extendWARNING: LV %s maps %s while the size is only %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.String list allocation failed for thin_pool.String list allocation failed for thin.WARNING: Ignoring invalid string in config file %s.Internal error: Segment %s has no pool.Failed to build uuid for pool LV %s.Internal error: Failed to add merged segment of %s.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.global/thin_disabled_featuresthinthin-poolUUID contains invalid character '%c'Couldn't write uuid, buffer too small.Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.uuid/uuid.c0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#zero/zero.czero module string list allocation failedactivate/dev_manager.cLV percent: %s-cmetaRunning check command on %s-VbetteroldercryptostratisCRYPT-TEMPCRYPT-SUBDEVstratis-blocked_mirrors block_on_error%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidfrozenunusable_thinsRemoving dm dev %u:%uPrelAdding new LV %s%s%s to dtree%*u:%*u %u%sblock/dm-%u/holdersFound holder %s of %s. origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s.dev_managerChecking device id for LV %s.V%u %*s %lu %*u %umissing_%d_%dFailed to set query_inactive_table.WARNING: Failed to disable open_count.WARNING: Failed to set no_flush.WARNING: Cannot find matching %s segment for %s.Internal error: WARNING: Segment type %s found does not match expected type %s for %s.Number of segments in active LV %s does not match metadata.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.Failed to allocated path for callback.Internal error: Registering unsupported pool callback.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.Internal error: Unable to find configuration for pool check options.Invalid string in config file: global/%s_check_options.Too many options for %s command.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).Getting device info for %s [%s].Failed to add device (%u:%u) to dtree.Tracking pending delete for %s %s (%s).Internal error: _emit_target cannot handle segment type %s.WARNING: Cannot get info from tree node for %s.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %d:%d.WARNING: Incorrect snapshot-origin table found for %d:%d.%s: Invalid %s device %s not usable.WARNING: %s frozen raid device (%d:%d) needs inspection.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %d:%d.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.%s: I/O blocked to mirror device.Failed to set device number for remove %u:%uWARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u)._add_new_lv_to_dtree: pool alloc failed for %s %s.Add cachevol %s to dtree before cache %s.Failed to add cachevol to dtree before cache.Using error for pending meta delete %s.Using error for pending data delete %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Tracking pending delete for %s (%s).Internal error: Cannot create tree for %s.Partial dtree creation failed for %s.Lost dependency tree root node._clean_tree: Couldn't split up device name %s._clean_tree: Failed to duplicate uuid.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Internal error: %s is not a writecache logical volume.Checking status for cache volume %s.Checking thin pool status for LV %s.Checking thin status for LV %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Checking VDO pool status for LV %s.Checking VDO pool table line for LV %s.Failed to parse VDO parameters %s for LV %s.WARNING: Unknown VDO table line version %u.Aborting. LV %s is now incomplete and '--activationmode partial' was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.PRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANactivate/fs.cRemoving link %s%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sSyncing device namesCouldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't construct name of volume group directory.No space to stack fs operationreasonlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %sOK abortprogress_infoin_progresssignalnot_foundlvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.For more information see lvmpolld messages in syslog or lvmpolld log file.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).Sucessfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid setInternal error: Use of lvmpolld requires vgname setInternal error: Use of lvmpolld requires lvname setAsking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Unsupported poll operationInternal error: use of lvmpolld requires uuid being setAsking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.Polling finished successfully.path_num = %ldFailed to create pvs request.locking/lvmlockd.cpath[%d] = %%sFailed to refresh %s.lockd_result reply error %dlockd_result bad responselockd_result no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSvg_name = %spid = %ldbusy_vgvg_lock_args = %svg_lock_type = %sfree_vginit_vgVG %s init failed: %dsanlock lvmlock LV removedFail to any PVs for VG %sVG %s find PV device %scmd = %slv_lock_args = %slv_uuid = %slv_name = %sopts = %smode = %slvmlockd %s %s result %d %xUnknown sector size %u.Failed to create internal lv./run/lvmlockd.pid/run/lvm/lvmlockd.socketfind_free_lockUnknown lock_type.start_initstart_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dlockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dstart_waitLock start failedlockd global lock_type %sUnknown lock-gl modelock_glRetrying %s global lockEnabling sanlock global lockGlobal lock failed: error %dlockd global mode %sGlobal lock failed: error %d.lockd VG %s mode %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dvg_updatelvextendlvresizelvchangelockd query LV %s/%squery_lock_lvLocking failed for LV %s/%sRefresh lvmlockNo vdo pool for %s/%sshupdatenorefresh/etc/mtabgfs2ocfs2%s/%s/%sinit_lvlv_lock_argslv_lock_args not returnedFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%sfree_lv_free_lv lvmlockd result %drename_vg_finalrunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmFailed to unlock LV %s/%s.rename_vg_beforerefresh_lvpath = %sLV refresh failed for LV %sExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV %s name too long - extended size not zeroed.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.lockd_result %d flags %s lm %sLockspace for "%s" not stopped on other hosts%s: lock type %s lvmlockd result %dVG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: lock_args alloc failedVG %s init failed: vg_write vg_commitFailed to deactivate sanlock lv %s/%sFailed to remove sanlock LV %s/%sFailed to activate sanlock lv %s/%sFail to allocate PV list for VG %sFail to allocate PV path for VG %slvmlockd %s %s vg %s lv %s result %d %xlvmlockd %s %s vg %s result %d %xlvmlockd %s %s failed no resultUsing sector size %u for sanlock LVCreating lvmlock LV for sanlock with size %um %ub %u extentsFailed to create sanlock lv %s in vg %sVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesShould not initialize lvmlockd with use_lvmlockd=0.WARNING: lvmlockd socket location is not configured.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.VG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %s init %dVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.Cannot create VG with lock_type %s without lvmlockd.Global lock failed: check that lvmlockd is running.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)Global lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is starting.Global lock failed: held by other host.VG create failed: lock manager %s is not supported by lvmlockd.Exclusive locks are not allowed with readonly option.Unknown lvmlockd global lock modeReading without shared global lock.lockd global mode %s already held.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: storage failed for sanlock leasesSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedVG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.Duplicate sanlock global lock in VG %sLV locks are not allowed with readonly option.Lock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedWARNING: shared LV may require refresh on other hosts where it is active.Shared activation not compatible with LV type %s of %s/%slockd LV %s/%s mode %s uuid %sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%sWARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLV in VG %s with lock_type %s requires lvmlockd.Cannot find thin pool for %s/%sLock on incorrect thin lv type %s/%sLock on incorrect vdo lv type %s/%sLV path too long for lvmlockd refresh.Lock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedlockd_init_lv: unknown lock_type.Cannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock origin LV %s/%sFailed to find thin pool %s/%sFailed to lock thin pool %s/%sCreate thin pool and thin LV separately with lock type %sUnknown thin options for lock init.lockd_free_lv: unknown lock_type.Failed to restart VG %s lockspace.lockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Failed to get result from lvmlockdFailed to find a running lock manager.LV %s/%s must be inactive on all hosts.Cannot change VG %s with active LVsGlobal lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_args_free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.LVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRefreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.|||||}}t}}t}h_free_vg_busy_vgvdo/vdo.cvdo_poolvdo_offset Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sonline_renameversion4Unknown logical volume %s.vdo_pool = "%s"vdo_offset = %uheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sInitialised segtypes: %s, %s.Internal error: Passed segment is not VDO pool.Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.String list allocation failed for VDO module.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.Internal error: Passed segment is not VDO type.Failed to allocate memory for VDO segtypes.global/vdo_disabled_featureskvdo ...command.cTagSelectDESC: %s _long--uuidstr prev OO:OO_OP:Cannot find command %s.lvreduceOO_ALL:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:Parsing command defs: no mem.LV_lv_is_ID:Failer to duplicate name %s.Failer to duplicate line %s.IO:OO_ALL -%c|%s (, %c%c [ --type %s ] (implied)[ --type %s|%s ] (implied) [ -l|--extents [ COMMON_OPTIONS ] [ Common options for lvm: Common options for command:devtypesdumpconfigformatsfullreportDisplay full reportDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfiglvmdevicesManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvscanList all physical volumessegtypesList available segment typesvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitCMD_NONEdevtypes_general_CMDdevtypes_generalformats_general_CMDformats_generalfullreport_general_CMDfullreport_generalhelp_general_CMDhelp_generallastlog_general_CMDlastlog_generallvchange_activate_CMDlvchange_activatelvchange_monitor_CMDlvchange_monitorlvchange_persistent_CMDlvchange_persistentlvchange_poll_CMDlvchange_polllvchange_properties_CMDlvchange_propertieslvchange_rebuild_CMDlvchange_rebuildlvchange_refresh_CMDlvchange_refreshlvchange_resync_CMDlvchange_resynclvchange_syncaction_CMDlvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_integrity_CMDlvconvert_integritylvconvert_merge_CMDlvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshot_CMDlvconvert_merge_snapshotlvconvert_merge_thin_CMDlvconvert_merge_thinlvconvert_plain_CMDlvconvert_plainlvconvert_raid_types_CMDlvconvert_raid_typeslvconvert_repair_CMDlvconvert_repairlvconvert_replace_pv_CMDlvconvert_replace_pvlvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_poll_CMDlvconvert_start_polllvconvert_swap_pool_metadatalvconvert_to_cachepool_CMDlvconvert_to_cachepoollvconvert_to_thinpool_CMDlvconvert_to_thinpoollvconvert_to_vdopool_CMDlvconvert_to_vdopoollvconvert_to_vdopool_paramlvconvert_to_writecache_CMDlvconvert_to_writecachelvcreate_and_attach_cachepoollvcreate_cachepool_CMDlvcreate_cachepoollvcreate_cow_snapshot_CMDlvcreate_cow_snapshotlvcreate_error_vol_CMDlvcreate_error_vollvcreate_linear_CMDlvcreate_linearlvcreate_mirror_CMDlvcreate_mirrorlvcreate_mirror_or_raid1_CMDlvcreate_mirror_or_raid1lvcreate_raid_any_CMDlvcreate_raid_anylvcreate_striped_CMDlvcreate_stripedlvcreate_thin_snapshot_CMDlvcreate_thin_snapshotlvcreate_thin_vol_CMDlvcreate_thin_vollvcreate_thinpool_CMDlvcreate_thinpoollvcreate_vdo_vol_CMDlvcreate_vdo_vollvcreate_zero_vol_CMDlvcreate_zero_vollvdisplay_general_CMDlvdisplay_generallvextend_by_policy_CMDlvextend_by_policylvextend_by_pv_CMDlvextend_by_pvlvextend_by_size_CMDlvextend_by_sizelvmchange_general_CMDlvmchange_generallvmconfig_general_CMDlvmconfig_generallvmdevices_check_CMDlvmdevices_checklvmdevices_edit_CMDlvmdevices_editlvmdevices_list_CMDlvmdevices_listlvmdevices_update_CMDlvmdevices_updatelvmdiskscan_general_CMDlvmdiskscan_generallvmsadc_general_CMDlvmsadc_generallvmsar_general_CMDlvmsar_generallvpoll_general_CMDlvpoll_generallvreduce_general_CMDlvreduce_generallvremove_general_CMDlvremove_generallvrename_lv_lv_CMDlvrename_lv_lvlvrename_vg_lv_lv_CMDlvrename_vg_lv_lvlvresize_by_pv_CMDlvresize_by_pvlvresize_by_size_CMDlvresize_by_sizelvs_general_CMDlvs_generallvscan_general_CMDlvscan_generalpvchange_properties_all_CMDpvchange_properties_allpvchange_properties_some_CMDpvchange_properties_somepvck_dump_CMDpvck_dumppvck_general_CMDpvck_generalpvck_repair_CMDpvck_repairpvck_repair_type_CMDpvck_repair_typepvcreate_general_CMDpvcreate_generalpvdata_general_CMDpvdata_generalpvdisplay_general_CMDpvdisplay_generalpvmove_any_CMDpvmove_anypvmove_one_CMDpvmove_onepvremove_general_CMDpvremove_generalpvresize_general_CMDpvresize_generalpvs_general_CMDpvs_generalpvscan_cache_CMDpvscan_cachepvscan_display_CMDpvscan_displaysegtypes_general_CMDsegtypes_generalsystemid_general_CMDsystemid_generaltags_general_CMDtags_generalversion_general_CMDversion_generalvgcfgbackup_general_CMDvgcfgbackup_generalvgcfgrestore_by_file_CMDvgcfgrestore_by_filevgcfgrestore_by_vg_CMDvgcfgrestore_by_vgvgcfgrestore_list_by_file_CMDvgcfgrestore_list_by_filevgcfgrestore_list_by_vg_CMDvgcfgrestore_list_by_vgvgchange_activate_CMDvgchange_activatevgchange_lockstart_CMDvgchange_lockstartvgchange_lockstop_CMDvgchange_lockstopvgchange_locktype_CMDvgchange_locktypevgchange_monitor_CMDvgchange_monitorvgchange_poll_CMDvgchange_pollvgchange_properties_CMDvgchange_propertiesvgchange_refresh_CMDvgchange_refreshvgchange_systemid_CMDvgchange_systemidvgck_general_CMDvgck_generalvgck_update_metadata_CMDvgck_update_metadatavgconvert_general_CMDvgconvert_generalvgcreate_general_CMDvgcreate_generalvgdisplay_general_CMDvgdisplay_generalvgexport_all_CMDvgexport_allvgexport_some_CMDvgexport_somevgextend_general_CMDvgextend_generalvgimport_all_CMDvgimport_allvgimport_some_CMDvgimport_somevgimportclone_general_CMDvgimportclone_generalvgimportdevices_all_CMDvgimportdevices_allvgimportdevices_some_CMDvgimportdevices_somevgmerge_general_CMDvgmerge_generalvgmknodes_general_CMDvgmknodes_generalvgreduce_all_CMDvgreduce_allvgreduce_by_pv_CMDvgreduce_by_pvvgreduce_missing_CMDvgreduce_missingvgremove_general_CMDvgremove_generalvgrename_by_name_CMDvgrename_by_namevgrename_by_uuid_CMDvgrename_by_uuidvgs_general_CMDvgs_generalvgscan_general_CMDvgscan_generalvgsplit_by_lv_CMDvgsplit_by_lvvgsplit_by_pv_CMDvgsplit_by_pvCMD_COUNTLVT_NONElinear_LVTstriped_LVTsnapshot_LVTthin_LVTthinpool_LVTcachepool_LVTvdo_LVTvdopool_LVTvdopooldata_LVTvdopooldatamirror_LVTraid_LVTraid0_LVTraid1_LVTraid4_LVTraid5_LVTraid6_LVTraid10_LVTerror_LVTzero_LVTwritecache_LVTintegrity_LVTLVT_COUNTLVP_NONEis_locked_LVPlv_is_lockedis_partial_LVPlv_is_partialis_virtual_LVPlv_is_virtualis_merging_LVPlv_is_mergingis_merging_origin_LVPlv_is_merging_originis_converting_LVPlv_is_convertingis_external_origin_LVPlv_is_external_originis_virtual_origin_LVPlv_is_virtual_originis_not_synced_LVPlv_is_not_syncedis_pending_delete_LVPlv_is_pending_deleteis_error_when_full_LVPlv_is_error_when_fullis_pvmove_LVPlv_is_pvmoveis_removed_LVPlv_is_removedis_vg_writable_LVPlv_is_vg_writableis_thinpool_data_LVPlv_is_thinpool_datais_thinpool_metadata_LVPlv_is_thinpool_metadatais_cachepool_data_LVPlv_is_cachepool_datais_cachepool_metadata_LVPlv_is_cachepool_metadatais_mirror_image_LVPlv_is_mirror_imageis_mirror_log_LVPlv_is_mirror_logis_raid_image_LVPlv_is_raid_imageis_raid_metadata_LVPlv_is_raid_metadatais_origin_LVPlv_is_originis_thick_origin_LVPlv_is_thick_originis_thick_snapshot_LVPlv_is_thick_snapshotis_thin_origin_LVPlv_is_thin_originis_thin_snapshot_LVPlv_is_thin_snapshotis_cache_origin_LVPlv_is_cache_originis_merging_cow_LVPlv_is_merging_cowis_cow_covering_origin_LVPlv_is_cow_covering_originis_visible_LVPlv_is_visibleis_historical_LVPlv_is_historicalis_raid_with_tracking_LVPlv_is_raid_with_trackingis_raid_with_integrity_LVPlv_is_raid_with_integrityLVP_COUNTARG_UNUSEDabort_ARG--abortactivationmode_ARG--activationmodeaddtag_ARG--addtagadddev_ARG--adddevdeldev_ARG--deldevaddpvid_ARG--addpviddelpvid_ARG--delpvidaligned_ARG--alignedalloc_ARG--allocatomic_ARG--atomicatversion_ARG--atversionsetautoactivation_ARG--setautoactivationbinary_ARG--binarybootloaderareasize_ARG--bootloaderareasizecache_long_ARG--cachecachemetadataformat_ARG--cachemetadataformatcachemode_ARG--cachemodecachepool_ARG--cachepoolThe name of a cache pool. cachevol_ARG--cachevolThe name of a cache volume. cachedevice_ARG--cachedevicecachesize_ARG--cachesizeThe size of cache to use. check_ARG--checkcommandprofile_ARG--commandprofilecompression_ARG--compression--configconfigreport_ARG--configreportSee \fBlvmreport\fP(7). configtype_ARG--typeconfigdataalignment_ARG--dataalignmentdataalignmentoffset_ARG--dataalignmentoffsetdeduplication_ARG--deduplicationdeltag_ARG--deltagdetachprofile_ARG--detachprofiledeviceidtype_ARG--deviceidtype--devicesdevicesfile_ARG--devicesfilediscards_ARG--discardsdriverloaded_ARG--driverloadeddump_ARG--dumperrorwhenfull_ARG--errorwhenfullforce_long_ARGforeign_ARG--foreignhandlemissingpvs_ARG--handlemissingpvsignoreadvanced_ARG--ignoreadvancedignorelocal_ARG--ignorelocalignorelockingfailure_ARG--ignorelockingfailureignoremonitoring_ARG--ignoremonitoringignoreskippedcluster_ARG--ignoreskippedclusterNo longer used. ignoreunsupported_ARG--ignoreunsupportedimportdevices_ARG--importdevicesjournal_ARG--journallabelsector_ARG--labelsectorlistlvs_ARG--listlvslistvg_ARG--listvgcheckcomplete_ARG--checkcompletelockopt_ARG--lockoptlockstart_ARG--lockstartlockstop_ARG--lockstoplocktype_ARG--locktypelogonly_ARG--logonlylonghelp_ARG--longhelpDisplay long help text. --maxrecoveryratemerge_ARG--mergemergemirrors_ARG--mergemirrorsmergesnapshot_ARG--mergesnapshotmergethin_ARG--mergethinmergedconfig_ARG--mergedconfigmetadataignore_ARG--metadataignoremetadataprofile_ARG--metadataprofile--metadatasizeminor_ARG--minor--minrecoveryratemirrorlog_ARG--mirrorlogmirrorsonly_ARG--mirrorsonlymknodes_ARG--mknodesmonitor_ARG--monitornameprefixes_ARG--nameprefixesnoheadings_ARG--noheadingsnohints_ARG--nohintsnohistory_ARG--nohistorynolocking_ARG--nolockingDisable locking. norestorefile_ARG--norestorefilenosuffix_ARG--nosuffixnosync_ARG--nosyncnotifydbus_ARG--notifydbusnoudevsync_ARG--noudevsyncoriginname_ARG--originnamesetphysicalvolumesize_ARG--setphysicalvolumesize--settings--pollpolloperation_ARG--polloperationpooldatasize_ARG--pooldatasizepoolmetadata_ARG--poolmetadatapoolmetadatasize_ARG--poolmetadatasizepoolmetadataspare_ARG--poolmetadataspare--profilepvmetadatacopies_ARG--pvmetadatacopiesraidintegrity_ARG--raidintegrityraidintegrityblocksize_ARG--raidintegrityblocksizeraidintegritymode_ARG--raidintegritymodereadonly_ARG--readonlyrefresh_ARG--refreshremovemissing_ARG--removemissing--rebuildrepair_ARG--repairrepairtype_ARG--repairtypereplace_ARG--replacereportformat_ARG--reportformat--restorefilerestoremissing_ARG--restoremissingresync_ARG--resyncrows_ARG--rowsOutput columns as rows. segments_ARG--segmentsseparator_ARG--separatorshared_ARG--sharedsinceversion_ARG--sinceversionsplitcache_ARG--splitcachesplitmirrors_ARG--splitmirrorssplitsnapshot_ARG--splitsnapshotshowdeprecated_ARG--showdeprecatedshowunsupported_ARG--showunsupportedstartpoll_ARG--startpollstripes_long_ARGswapmetadata_ARG--swapmetadata--syncactionsysinit_ARG--sysinitsystemid_ARG--systemidthinpool_ARG--thinpoolThe name of a thin pool LV. trackchanges_ARG--trackchangestrustcache_ARG--trustcache--typeudevoutput_ARG--udevoutputunbuffered_ARG--unbuffereduncache_ARG--uncacheupdate_ARG--updatecachepolicy_ARG--cachepolicycachesettings_ARG--cachesettingsunconfigured_ARG--unconfiguredunits_ARG--unitsunquoted_ARG--unquotedusepolicies_ARG--usepoliciesvalidate_ARG--validatevdo_ARG--vdovdopool_ARG--vdopoolvdosettings_ARG--vdosettings--versionDisplay version information. vgmetadatacopies_ARG--vgmetadatacopiesvgonline_ARG--vgonlinewithsummary_ARG--withsummarywithcomments_ARG--withcommentswithgeneralpreamble_ARG--withgeneralpreamblewithlocalpreamble_ARG--withlocalpreamblewithspaces_ARG--withspaceswithversions_ARG--withversions--writebehind--writemostlycorelog_ARG--corelogresizable_ARG--resizableallocation_ARG--allocationavailable_ARG--availableraidrebuild_ARG--raidrebuildraidsyncaction_ARG--raidsyncactionraidwritemostly_ARG--raidwritemostlyraidminrecoveryrate_ARG--raidminrecoveryrateraidmaxrecoveryrate_ARG--raidmaxrecoveryrateraidwritebehind_ARG--raidwritebehindvirtualoriginsize_ARG--virtualoriginsizesplit_ARG--split--metadatacopiesactivate_ARG--activateall_ARG--allautobackup_ARG--autobackupactivevolumegroups_ARG--activevolumegroupsbackground_ARG--backgroundbasevgname_ARG--basevgnameblockdevice_ARG--blockdevicechunksize_ARG--chunksizeclustered_ARG--clusteredcolon_ARG--coloncolumns_ARG--columnscontiguous_ARG--contiguousdebug_ARG--debugexported_ARG--exportedphysicalextent_ARG--physicalextent--fileforce_ARG--full--helpDisplay help text. --historyhelp2_ARGimport_ARG--importinterval_ARG--intervaliop_version_ARG--iop_versionstripes_ARGstripesize_ARGlogicalvolume_ARG--logicalvolumemaxlogicalvolumes_ARG--maxlogicalvolumesextents_ARG--extents--listlvmpartition_ARG--lvmpartitionOnly report PVs. --sizepersistent_ARG--persistentmajor_ARG--majorsetactivationskip_ARG--setactivationskipignoreactivationskip_ARG--ignoreactivationskipmaps_ARG--maps--mirrorsmetadatatype_ARG--metadatatype--namenofsck_ARG--nofscknovolumegroup_ARG--novolumegroupoldpath_ARG--oldpathoptions_ARG--optionssort_ARG--sortmaxphysicalvolumes_ARG--maxphysicalvolumespermission_ARG--permissionpartial_ARG--partialphysicalvolume_ARG--physicalvolumequiet_ARG--quietreadahead_ARG--readaheadresizefs_ARG--resizefsreset_ARG--resetregionsize_ARGphysicalextentsize_ARG--physicalextentsize--snapshotshort_ARG--shortstdin_ARG--stdinselect_ARG--selecttest_ARG--test--thinupdatemetadata_ARG--updatemetadatauuid_ARG--uuiduuidstr_ARGuuidlist_ARG--uuidlistverbose_ARG--volumegroupvirtualsize_ARG--virtualsizewipesignatures_ARG--wipesignaturesallocatable_ARG--allocatableresizeable_ARG--resizeableyes_ARGzero_ARG--zeroARG_COUNTnone_VALERRconststr_VALConstStringconstnum_VALConstNumberbool_VALBooly|nsnumber_VALSNumber[+|-]Numberpnumber_VALPNumber[+]Numberuint32_VALUint32string_VALvg_VALlv_VALpv_VALtag_VALselect_VALactivationmode_VALActivationModepartial|degraded|completeactivation_VALActivey|n|aycachemetadataformat_VALCacheMetadataFormatauto|1|2cachemode_VALCacheModediscards_VALDiscardspassdown|nopassdown|ignoremirrorlog_VALMirrorLogcore|diskssizekb_VALSSizeKB[+|-]Size[k|UNIT]ssizemb_VALSSizeMB[+|-]Size[m|UNIT]psizemb_VALPSizeMB[+]Size[m|UNIT]NSizeMB[-]Size[m|UNIT]regionsizemb_VALRegionSizesextents_VALSExtents[+|-]Number[PERCENT]pextents_VALPExtents[+]Number[PERCENT]nextents_VALNExtents[-]Number[PERCENT]permission_VALPermissionrw|rmetadatatype_VALMetadataTypeunits_VALUnitssegtype_VALSegTypealloc_VALAlloclocktype_VALLockTypesanlock|dlm|nonereadahead_VALReadaheadauto|none|Numbervgmetadatacopies_VALMetadataCopiesVGall|unmanaged|Numberpvmetadatacopies_VALMetadataCopiesPV0|1|2unusedpolloperation_VALPollOpwritemostly_VALWriteMostlyPVPV[:t|n|y]syncaction_VALSyncActioncheck|repairreportformat_VALReportFmtbasic|jsonconfigreport_VALConfigReportlog|vg|lv|pv|pvseg|segconfigtype_VALConfigTyperepairtype_VALRepairTypedumptype_VALDumpTypeVAL_COUNTParsing command defs: options must be specified in long form: %s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown pos arg: %s.Parsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown opt arg: %s.Parsing command defs: option %s must be followed by an arg.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.File cmds.h has unsorted name entry %s.File commands.h has unsorted name entry %s.Parsing command defs: too many rules for cmd.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE]... is start and end range (inclusive), PV[:PE+PE]... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.)Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume grouplvconvert_change_mirrorlog_CMDlvconvert_change_region_size_CMDlvconvert_combine_split_snapshot_CMDlvconvert_combine_split_snapshotlvconvert_merge_mirror_images_CMDlvconvert_split_and_keep_cache_CMDlvconvert_split_and_keep_cachelvconvert_split_and_remove_cache_CMDlvconvert_split_and_remove_cachelvconvert_split_cow_snapshot_CMDlvconvert_split_mirror_images_CMDlvconvert_swap_pool_metadata_CMDlvconvert_to_cache_with_cachepool_CMDlvconvert_to_cache_with_cachepoollvconvert_to_cache_with_cachevol_CMDlvconvert_to_cache_with_cachevollvconvert_to_cache_with_device_CMDlvconvert_to_cache_with_devicelvconvert_to_cachepool_or_swap_metadata_CMDlvconvert_to_cachepool_or_swap_metadatalvconvert_to_thin_with_external_CMDlvconvert_to_thin_with_externallvconvert_to_thinpool_or_swap_metadata_CMDlvconvert_to_thinpool_or_swap_metadatalvconvert_to_vdopool_param_CMDlvconvert_to_writecache_with_device_CMDlvconvert_to_writecache_with_devicelvcreate_and_attach_cachedevice_for_cache_CMDlvcreate_and_attach_cachedevice_for_cachelvcreate_and_attach_cachedevice_for_writecache_CMDlvcreate_and_attach_cachedevice_for_writecachelvcreate_and_attach_cachepool_CMDlvcreate_and_attach_cachepool_v2_CMDlvcreate_and_attach_cachepool_v2lvcreate_and_attach_cachepool_v3_CMDlvcreate_and_attach_cachepool_v3lvcreate_and_attach_cachevol_for_cache_CMDlvcreate_and_attach_cachevol_for_cachelvcreate_and_attach_cachevol_for_writecache_CMDlvcreate_and_attach_cachevol_for_writecachelvcreate_cow_snapshot_with_virtual_origin_CMDlvcreate_cow_snapshot_with_virtual_originlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool_CMDlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoollvcreate_thin_snapshot_of_external_CMDlvcreate_thin_snapshot_of_externallvcreate_thin_vol_and_thinpool_CMDlvcreate_thin_vol_and_thinpoollvcreate_thin_vol_with_thinpool_or_sparse_snapshot_CMDlvcreate_thin_vol_with_thinpool_or_sparse_snapshotlvextend_pool_metadata_by_size_CMDlvextend_pool_metadata_by_sizelvresize_pool_metadata_by_size_CMDlvresize_pool_metadata_by_size#pvmove Abort any pvmove operations in progress. If a pvmove was started with the --atomic option, then all LVs will remain on the source PV. Otherwise, segments that have been moved will remain on the destination PV, while unmoved segments will remain on the source PV. #lvpoll Stop processing a poll operation in lvmpolld. Determines if LV activation is allowed when PVs are missing, e.g. because of a device failure. \fBcomplete\fP only allows LVs with no missing PVs to be activated, and is the most restrictive mode. \fBdegraded\fP allows RAID LVs with missing PVs to be activated. (This does not include the "mirror" type, see "raid1" instead.) \fBpartial\fP allows any LV with missing PVs to be activated, and should only be used for recovery or repair. For default, see \fBlvm.conf\fP(5) activation_mode. See \fBlvmraid\fP(7) for more information. Adds a tag to a PV, VG or LV. This option can be repeated to add multiple tags at once. See \fBlvm\fP(8) for information about tags. Add a device to the devices file. Remove a device from the devices file. Find a device with the PVID and add the device to the devices file. Remove a device with the PVID from the devices file. Use with --separator to align the output columns Determines the allocation policy when a command needs to allocate Physical Extents (PEs) from the VG. Each VG and LV has an allocation policy which can be changed with vgchange/lvchange, or overridden on the command line. \fBnormal\fP applies common sense rules such as not placing parallel stripes on the same PV. \fBinherit\fP applies the VG policy to an LV. \fBcontiguous\fP requires new PEs be placed adjacent to existing PEs. \fBcling\fP places new PEs on the same PV as existing PEs in the same stripe of the LV. If there are sufficient PEs for an allocation, but normal does not use them, \fBanywhere\fP will use them even if it reduces performance, e.g. by placing two stripes on the same PV. Optional positional PV args on the command line can also be used to limit which PVs the command will use for allocation. See \fBlvm\fP(8) for more information about allocation. Makes a pvmove operation atomic, ensuring that all affected LVs are moved to the destination PV, or none are if the operation is aborted. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). When configuration is displayed, the configuration settings recognized at this LVM version will be considered only. This can be used to display a configuration that a certain LVM version understands and which does not contain any newer settings for which LVM would issue a warning message when checking the configuration. Set the autoactivation property on a VG or LV. Display the property with vgs or lvs "-o autoactivation". When the autoactivation property is disabled, the VG or LV will not be activated by a command doing autoactivation (vgchange, lvchange, or pvscan using -aay.) If autoactivation is disabled on a VG, no LVs will be autoactivated in that VG, and the LV autoactivation property has no effect. If autoactivation is enabled on a VG, autoactivation can be disabled for individual LVs. Use binary values "0" or "1" instead of descriptive literal values for columns that have exactly two valid values to report (not counting the "unknown" value which denotes that the value could not be determined). Reserve space for the bootloader between the LVM metadata area and the first PE. The bootloader area is reserved for bootloaders to embed their own data or metadata; LVM will not use it. The bootloader area begins where the first PE would otherwise be located. The first PE is moved out by the size of the bootloader area, and then moved out further if necessary to match the data alignment. The start of the bootloader area is always aligned, see also --dataalignment and --dataalignmentoffset. The bootloader area may be larger than requested due to the alignment, but it's never less than the requested size. To see the bootloader area start and size of an existing PV use pvs -o +pv_ba_start,pv_ba_size. #pvscan Scan one or more devices and record that they are online. #vgscan This option is no longer used. #lvscan This option is no longer used. Specifies the cache metadata format used by cache target. Specifies when writes to a cache LV should be considered complete. \fBwriteback\fP considers a write complete as soon as it is stored in the cache pool. \fBwritethough\fP considers a write complete only when it has been stored in both the cache pool and on the origin LV. While writethrough may be slower for writes, it is more resilient if something should happen to a device associated with the cache pool LV. With \fBpassthrough\fP, all reads are served from the origin LV (all reads miss the cache) and all writes are forwarded to the origin LV; additionally, write hits cause cache block invalidates. See \fBlvmcache\fP(7) for more information. The name of a device to use for a cache. Checks the content of the devices file. Reports incorrect device names or PVIDs for entries. The command profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. Controls whether compression is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Config settings for the command. These override \fBlvm.conf\fP(5) settings. The String arg uses the same format as \fBlvm.conf\fP(5), or may use section/field syntax. See \fBlvm.conf\fP(5) for more information about config. \fBcurrent\fP prints the config settings that would be applied to an lvm command (assuming the command does not override them on the command line.) This includes: settings that have been modified in lvm config files, settings that get their default values from config files, and default settings that have been uncommented in config files. \fBdefault\fP prints all settings with their default values. Changes made in lvm config files are not reflected in the output. Some settings get their default values internally, and these settings are printed as comments. Other settings get their default values from config files, and these settings are not printed as comments. \fBdiff\fP prints only config settings that have been modified from their default values in config files (the difference between current and default.) \fBfull\fP prints every setting uncommented and set to the current value, i.e. how it would be used by an lvm command. This includes settings modified in config files, settings that usually get defaults internally, and settings that get defaults from config files. \fBlist\fP prints all config names without values. \fBmissing\fP prints settings that are missing from the lvm config files. A missing setting that usually gets its default from config files is printed uncommented and set to the internal default. Settings that get their default internally and are not set in config files are printed commented with the internal default. \fBnew\fP prints config settings that have been added since the lvm version specified by --sinceversion. They are printed with their default values. \fBprofilable\fP prints settings with their default values that can be set from a profile. \fBprofilable-command\fP prints settings with their default values that can be set from a command profile. \fBprofilable-metadata\fP prints settings with their default values that can be set from a metadata profile. Also see \fBlvm.conf\fP(5). Align the start of a PV data area with a multiple of this number. To see the location of the first Physical Extent (PE) of an existing PV, use pvs -o +pe_start. In addition, it may be shifted by an alignment offset, see --dataalignmentoffset. Also specify an appropriate PE size when creating a VG. Shift the start of the PV data area by this additional offset. Controls whether deduplication is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Deletes a tag from a PV, VG or LV. This option can be repeated to delete multiple tags at once. See \fBlvm\fP(8) for information about tags. Detaches a metadata profile from a VG or LV. See \fBlvm.conf\fP(5) for more information about profiles. The type of device ID to use for the device. If the specified type is available for the device, then it will override the default type that lvm would use. Restricts the devices that are visible and accessible to the command. Devices not listed will appear to be missing. This option can be repeated, or accepts a comma separated list of devices. This overrides the devices file. A file listing devices that LVM should use. The file must exist in \fI#DEFAULT_SYS_DIR#/devices/\fP and is managed with the \fBlvmdevices\fP(8) command. This overrides the \fBlvm.conf\fP(5) \fBdevices/devicesfile\fP and \fBdevices/use_devicesfile\fP settings. Specifies how the device-mapper thin pool layer in the kernel should handle discards. \fBignore\fP causes the thin pool to ignore discards. \fBnopassdown\fP causes the thin pool to process discards itself to allow reuse of unneeded extents in the thin pool. \fBpassdown\fP causes the thin pool to process discards itself (like nopassdown) and pass the discards to the underlying device. See \fBlvmthin\fP(7) for more information. If set to no, the command will not attempt to use device-mapper. For testing and debugging. Dump headers and metadata from a PV for debugging and repair. Option values include: \fBheaders\fP to print and check LVM headers, \fBmetadata\fP to print or save the current text metadata, \fBmetadata_all\fP to list or save all versions of metadata, \fBmetadata_search\fP to list or save all versions of metadata, searching standard locations in case of damaged headers, \fBmetadata_area\fP to save an entire text metadata area to a file. Specifies thin pool behavior when data space is exhausted. When yes, device-mapper will immediately return an error when a thin pool is full and an I/O request requires space. When no, device-mapper will queue these I/O requests for a period of time to allow the thin pool to be extended. Errors are returned if no space is available after the timeout. (Also see dm-thin-pool kernel module option no_space_timeout.) See \fBlvmthin\fP(7) for more information. Force metadata restore even with thin pool LVs. Use with extreme caution. Most changes to thin metadata cannot be reverted. You may lose data if you restore metadata that does not match the thin pool kernel metadata precisely. Report/display foreign VGs that would otherwise be skipped. See \fBlvmsystemid\fP(7) for more information about foreign VGs. Allows a polling operation to continue when PVs are missing, e.g. for repairs due to faulty devices. Exclude advanced configuration settings from the output. Ignore the local section. The local section should be defined in the lvmlocal.conf file, and should contain config settings specific to the local host which should not be copied to other hosts. Allows a command to continue with read-only metadata operations after locking failures. Do not interact with dmeventd unless --monitor is specified. Do not use this if dmeventd is already monitoring a device. Exclude unsupported configuration settings from the output. These settings are either used for debugging and development purposes only or their support is not yet complete and they are not meant to be used in production. The \fBcurrent\fP and \fBdiff\fP types include unsupported settings in their output by default, all the other types ignore unsupported settings. Add devices to the devices file. Record information in the systemd journal. This information is in addition to information enabled by the lvm.conf log/journal setting. command: record information about the command. output: record the default command output. debug: record full command debugging. By default the PV is labelled with an LVM2 identifier in its second sector (sector 1). This lets you use a different sector near the start of the disk (between 0 and 3 inclusive - see LABEL_SCAN_SECTORS in the source). Use with care. Print a list of LVs that use the device. Print the VG that uses the device. Check if all the devices used by a VG or LV are present, and print "complete" or "incomplete" for each listed VG or LV. This option is used as a part of event-based autoactivation, so pvscan will do nothing if this option is set and event_activation=0 in the config settings. Used to pass options for special cases to lvmlockd. See \fBlvmlockd\fP(8) for more information. Start the lockspace of a shared VG in lvmlockd. lvmlockd locks becomes available for the VG, allowing LVM to use the VG. See \fBlvmlockd\fP(8) for more information. Stop the lockspace of a shared VG in lvmlockd. lvmlockd locks become unavailable for the VG, preventing LVM from using the VG. See \fBlvmlockd\fP(8) for more information. #vgchange Change the VG lock type to or from a shared lock type used with lvmlockd. See \fBlvmlockd\fP(8) for more information. #vgcreate Specify the VG lock type directly in place of using --shared. See \fBlvmlockd\fP(8) for more information. Suppress command report and display only log report. Sets the maximum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. An alias for --mergethin, --mergemirrors, or --mergesnapshot, depending on the type of LV. Merge LV images that were split from a raid1 LV. See --splitmirrors with --trackchanges. Merge COW snapshot LV into its origin. When merging a snapshot, if both the origin and snapshot LVs are not open, the merge will start immediately. Otherwise, the merge will start the first time either the origin or snapshot LV are activated and both are closed. Merging a snapshot into an origin that cannot be closed, for example a root filesystem, is deferred until the next time the origin volume is activated. When merging starts, the resulting LV will have the origin's name, minor number and UUID. While the merge is in progress, reads or writes to the origin appear as being directed to the snapshot being merged. When the merge finishes, the merged snapshot is removed. Multiple snapshots may be specified on the command line or a @tag may be used to specify multiple snapshots be merged to their respective origin. Merge thin LV into its origin LV. The origin thin LV takes the content of the thin snapshot, and the thin snapshot LV is removed. See \fBlvmthin\fP(7) for more information. When the command is run with --config and/or --commandprofile (or using LVM_COMMAND_PROFILE environment variable), --profile, or --metadataprofile, merge all the contents of the "config cascade" before displaying it. Without merging, only the configuration at the front of the cascade is displayed. See \fBlvm.conf\fP(5) for more information about config. Specifies the metadataignore property of a PV. If yes, metadata areas on the PV are ignored, and lvm will not store metadata in the metadata areas of the PV. If no, lvm will store metadata on the PV. The metadata profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. The approximate amount of space used for each VG metadata area. The size may be rounded. #lvcreate #lvchange Sets the minor number of an LV block device. #pvscan The minor number of a device. Sets the minimum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. Specifies the type of mirror log for LVs with the "mirror" type (does not apply to the "raid1" type.) \fBdisk\fP is a persistent log and requires a small amount of storage space, usually on a separate device from the data being mirrored. \fBcore\fP is not persistent; the log is kept only in memory. In this case, the mirror must be synchronized (by copying LV data from the first device to others) each time the LV is activated, e.g. after reboot. \fBmirrored\fP is a persistent log that is itself mirrored, but should be avoided. Instead, use the raid1 type for log redundancy. Only remove missing PVs from mirror LVs. Also checks the LVM special files in /dev that are needed for active LVs and creates any missing ones and removes unused ones. Start (yes) or stop (no) monitoring an LV with dmeventd. dmeventd monitors kernel events for an LV, and performs automated maintenance for the LV in reponse to specific events. See \fBdmeventd\fP(8) for more information. Add an "LVM2_" prefix plus the field name to the output. Useful with --noheadings to produce a list of field=value pairs that can be used to set environment variables (for example, in udev rules). Suppress the headings line that is normally the first line of output. Useful if grepping the output. Do not use the hints file to locate devices for PVs. A command may read more devices to find PVs when hints are not used. The command will still perform standard hint file invalidation where appropriate. Do not record history of LVs being removed. This has no effect unless the configuration setting metadata/record_lvs_history is enabled. In conjunction with --uuid, this allows a uuid to be specified without also requiring that a backup of the metadata be provided. Suppress the suffix on output sizes. Use with --units (except h and H) if processing the output. Causes the creation of mirror, raid1, raid4, raid5 and raid10 to skip the initial synchronization. In case of mirror, raid1 and raid10, any data written afterwards will be mirrored, but the original contents will not be copied. In case of raid4 and raid5, no parity blocks will be written, though any data written afterwards will cause parity blocks to be stored. This is useful for skipping a potentially long and resource intensive initial sync of an empty mirror/raid1/raid4/raid5 and raid10 LV. This option is not valid for raid6, because raid6 relies on proper parity (P and Q Syndromes) being created during initial synchronization in order to reconstruct proper user date in case of device failures. raid0 and raid0_meta do not provide any data copies or parity support and thus do not support initial synchronization. Send a notification to D-Bus. The command will exit with an error if LVM is not built with support for D-Bus notification, or if the notify_dbus config setting is disabled. Disables udev synchronisation. The process will not wait for notification from udev. It will continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. Specifies the name to use for the external origin LV when converting an LV to a thin LV. The LV being converted becomes a read-only external origin with this name. Overrides the automatically detected size of the PV. Use with care, or prior to reducing the physical size of the device. Specifies command specific settings in "Key = Value" form. Combine multiple settings in quotes, or repeat the settings option for each. When yes, start the background transformation of an LV. An incomplete transformation, e.g. pvmove or lvconvert interrupted by reboot or crash, can be restarted from the last checkpoint with --poll y. When no, background transformation of an LV will not occur, and the transformation will not complete. It may not be appropriate to immediately poll an LV after activation, in which case --poll n can be used to defer polling until a later --poll y command. The command to perform from lvmpolld. The name of a an LV to use for storing pool metadata. #lvcreate #lvconvert Specifies the size of the new pool metadata LV. #lvresize #lvextend Specifies the new size of the pool metadata LV. The plus prefix \fB+\fP can be used, in which case the value is added to the current size. Enable or disable the automatic creation and management of a spare pool metadata LV in the VG. A spare metadata LV is reserved space that can be used when repairing a pool. An alias for --commandprofile or --metadataprofile, depending on the command. The number of metadata areas to set aside on a PV for storing VG metadata. When 2, one copy of the VG metadata is stored at the front of the PV and a second copy is stored at the end. When 1, one copy of the VG metadata is stored at the front of the PV. When 0, no copies of the VG metadata are stored on the given PV. This may be useful in VGs containing many PVs (this places limitations on the ability to use vgsplit later.) Enable or disable data integrity checksums for raid images. The block size to use for dm-integrity on raid images. The integrity block size should usually match the device logical block size, or the file system block size. It may be less than the file system block size, but not less than the device logical block size. Possible values: 512, 1024, 2048, 4096. Use a journal (default) or bitmap for keeping integrity checksums consistent in case of a crash. The bitmap areas are recalculated after a crash, so corruption in those areas would not be detected. A journal does not have this problem. The journal mode doubles writes to storage, but can improve performance for scattered writes packed into a single journal write. bitmap mode can in theory achieve full write throughput of the device, but would not benefit from the potential scattered write optimization. Run the command in a special read-only mode which will read on-disk metadata without needing to take any locks. This can be used to peek inside metadata used by a virtual machine image while the virtual machine is running. No attempt will be made to communicate with the device-mapper kernel driver, so this option is unable to report whether or not LVs are actually in use. If the LV is active, reload its metadata. This is not necessary in normal operation, but may be useful if something has gone wrong, or if some form of manual LV sharing is being used. Removes all missing PVs from the VG, if there are no LVs allocated on them. This resumes normal operation of the VG (new LVs may again be created, changed and so on). If this is not possible because LVs are referencing the missing PVs, this option can be combined with --force to have the command remove any partial LVs. In this case, any LVs and dependent snapshots that were partly on the missing disks are removed completely, including those parts on disks that are still present. If LVs spanned several disks, including ones that are lost, salvaging some data first may be possible by activating LVs in partial mode. Selects a PV to rebuild in a raid LV. Multiple PVs can be rebuilt by repeating this option. Use this option in place of --resync or --syncaction repair when the PVs with corrupted data are known, and their data should be reconstructed rather than reconstructing default (rotating) data. See \fBlvmraid\fP(7) for more information. #lvconvert Replace failed PVs in a raid or mirror LV, or run a repair utility on a thin pool. See \fBlvmraid\fP(7) and \fBlvmthin\fP(7) for more information. #pvck Repair headers and metadata on a PV. Repair headers and metadata on a PV. See command description. Replace a specific PV in a raid LV with another PV. The new PV to use can be optionally specified after the LV. Multiple PVs can be replaced by repeating this option. See \fBlvmraid\fP(7) for more information. Overrides current output format for reports which is defined globally by the report/output_format setting in \fBlvm.conf\fP(5). \fBbasic\fP is the original format with columns and rows. If there is more than one report per command, each report is prefixed with the report name for identification. \fBjson\fP produces report output in JSON format. See \fBlvmreport\fP(7) for more information. In conjunction with --uuid, this reads the file (produced by vgcfgbackup), extracts the location and size of the data on the PV, and ensures that the metadata produced by the program is consistent with the contents of the file, i.e. the physical extents will be in the same place and not be overwritten by new metadata. This provides a mechanism to upgrade the metadata format or to add/remove metadata areas. Use with care. Add a PV back into a VG after the PV was missing and then returned, e.g. due to a transient failure. The PV is not reinitialized. Initiates mirror synchronization. Synchronization generally happens automatically, but this option forces it to run. Also see --rebuild to synchronize a specific PV. During synchronization, data is read from the primary mirror device and copied to the others. This can take considerable time, during which the LV is without a complete redundant copy of the data. See \fBlvmraid\fP(7) for more information. #pvs Produces one line of output for each contiguous allocation of space on each PV, showing the start (pvseg_start) and length (pvseg_size) in units of physical extents. #lvs Use default columns that emphasize segment information. String to use to separate each column. Useful if grepping the output. #vgcreate Create a shared VG using lvmlockd if LVM is compiled with lockd support. lvmlockd will select lock type sanlock or dlm depending on which lock manager is running. This allows multiple hosts to share a VG on shared devices. lvmlockd and a lock manager must be configured and running. See \fBlvmlockd\fP(8) for more information about shared VGs. #vgs #lvs #pvs #fullreport #vgdisplay #lvdisplay #pvdisplay Report/display shared VGs that would otherwise be skipped when lvmlockd is not being used on the host. See \fBlvmlockd\fP(8) for more information about shared VGs. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). This option is currently applicable only with --typeconfig new to display all configuration settings introduced since given version. Separates a cache pool from a cache LV, and keeps the unused cache pool LV. Before the separation, the cache is flushed. Also see --uncache. Splits the specified number of images from a raid1 or mirror LV and uses them to create a new LV. If --trackchanges is also specified, changes to the raid1 LV are tracked while the split LV remains detached. If --name is specified, then the images are permanently split from the original LV and changes are not tracked. Separates a COW snapshot from its origin LV. The LV that is split off contains the chunks that differ from the origin LV along with metadata describing them. This LV can be wiped and then destroyed with lvremove. Include deprecated configuration settings in the output. These settings are deprecated after a certain version. If a concrete version is specified with --atversion, deprecated settings are automatically included if the specified version is lower than the version in which the settings were deprecated. The current and diff types include deprecated settings in their output by default, all the other types ignore deprecated settings. Include unsupported configuration settings in the output. These settings are either used for debugging or development purposes only, or their support is not yet complete and they are not meant to be used in production. The current and diff types include unsupported settings in their output by default, all the other types ignore unsupported settings. Start polling an LV to continue processing a conversion. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not apply to existing allocated space, only newly allocated space can be striped. Extracts the metadata LV from a pool and replaces it with another specified LV. The extracted LV is preserved and given the name of the LV that replaced it. Use for repair only. When the metadata LV is swapped out of the pool, it can be activated directly and used with thin provisioning tools: \fBcache_dump\fP(8), \fBcache_repair\fP(8), \fBcache_restore\fP(8), \fBthin_dump\fP(8), \fBthin_repair\fP(8), \fBthin_restore\fP(8). Initiate different types of RAID synchronization. This causes the RAID LV to read all data and parity blocks in the array and check for discrepancies (mismatches between mirrors or incorrect parity values). \fBcheck\fP will count but not correct discrepancies. \fBrepair\fP will correct discrepancies. See \fBlvs\fP(8) for reporting discrepancies found or repaired. Indicates that vgchange/lvchange is being invoked from early system initialisation scripts (e.g. rc.sysinit or an initrd), before writable filesystems are available. As such, some functionality needs to be disabled and this option acts as a shortcut which selects an appropriate set of options. Currently, this is equivalent to using --ignorelockingfailure, --ignoremonitoring, --poll n, and setting env var LVM_SUPPRESS_LOCKING_FAILURE_MESSAGES. vgchange/lvchange skip autoactivation, and defer to pvscan autoactivation. #vgcreate Specifies the system ID that will be given to the new VG, overriding the system ID of the host running the command. A VG is normally created without this option, in which case the new VG is given the system ID of the host creating it. Using this option requires caution because the system ID of the new VG may not match the system ID of the host running the command, leaving the VG inaccessible to the host. See \fBlvmsystemid\fP(7) for more information. #vgchange Changes the system ID of the VG. Using this option requires caution because the VG may become foreign to the host running the command, leaving the host unable to access it. See \fBlvmsystemid\fP(7) for more information. Can be used with --splitmirrors on a raid1 LV. This causes changes to the original raid1 LV to be tracked while the split images remain detached. This is a temporary state that allows the read-only detached image to be merged efficiently back into the raid1 LV later. Only the regions with changed data are resynchronized during merge. While a raid1 LV is tracking changes, operations on it are limited to merging the split image (see --mergemirrors) or permanently splitting the image (see --splitmirrors with --name. The LV type, also known as "segment type" or "segtype". See usage descriptions for the specific ways to use these types. For more information about redundancy and performance (\fBraid\fP, \fBmirror\fP, \fBstriped\fP, \fBlinear\fP) see \fBlvmraid\fP(7). For thin provisioning (\fBthin\fP, \fBthin-pool\fP) see \fBlvmthin\fP(7). For performance caching (\fBcache\fP, \fBcache-pool\fP) see \fBlvmcache\fP(7). For copy-on-write snapshots (\fBsnapshot\fP) see usage definitions. For VDO (\fBvdo\fP) see \fBlvmvdo\fP(7). Several commands omit an explicit type option because the type is inferred from other options or shortcuts (e.g. --stripes, --mirrors, --snapshot, --virtualsize, --thin, --cache, --vdo). Use inferred types with care because it can lead to unexpected results. Command output is modified to be imported from a udev rule. Produce output immediately without sorting or aligning the columns properly. Separates a cache pool from a cache LV, and deletes the unused cache pool LV. Before the separation, the cache is flushed. Also see --splitcache. Update the content of the devices file. Specifies the cache policy for a cache LV. See \fBlvmcache\fP(7) for more information. Specifies tunable values for a cache LV in "Key = Value" form. Repeat this option to specify multiple values. (The default values should usually be adequate.) The special string value \fBdefault\fP switches settings back to their default kernel values and removes them from the list of settings stored in LVM metadata. See \fBlvmcache\fP(7) for more information. Internal option used for generating config file during build. All sizes are output in these units: human-(r)eadable with '<' rounding indicator, (h)uman-readable, (b)ytes, (s)ectors, (k)ilobytes, (m)egabytes, (g)igabytes, (t)erabytes, (p)etabytes, (e)xabytes. Capitalise to use multiples of 1000 (S.I.) instead of 1024. Custom units can be specified, e.g. --units 3M. When used with --nameprefixes, output values in the field=value pairs are not quoted. Perform an operation according to the policy configured in \fBlvm.conf\fP(5) or a profile. Validate current configuration used and exit with appropriate return code. The validation is done only for the configuration at the front of the "config cascade". To validate the whole merged configuration tree, also use --mergedconfig. The validation is done even if \fBlvm.conf\fP(5) \fBconfig/checks\fP is disabled. Specifies the command is handling VDO LV. See --type vdo. See \fBlvmvdo\fP(7) for more information about VDO usage. The name of a VDO pool LV. See \fBlvmvdo\fP(7) for more information about VDO usage. Specifies tunable VDO options for VDO LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --vdosettings for each option being set. These settings override the default VDO behaviors. To remove vdosettings and revert to the default VDO behaviors, use --vdosettings 'default'. See \fBlvmvdo\fP(7) for more information. Number of copies of the VG metadata that are kept. VG metadata is kept in VG metadata areas on PVs in the VG, i.e. reserved space at the start and/or end of the PVs. Keeping a copy of the VG metadata on every PV can reduce performance in VGs containing a large number of PVs. When this number is set to a non-zero value, LVM will automatically choose PVs on which to store metadata, using the metadataignore flags on PVs to achieve the specified number. The number can also be replaced with special string values: \fBunmanaged\fP causes LVM to not automatically manage the PV metadataignore flags. \fBall\fP causes LVM to first clear the metadataignore flags on all PVs, and then to become unmanaged. The first command to see a complete VG will report it uniquely. Other commands to see the complete VG will report it differently. Display a one line comment for each configuration node. Display a full comment for each configuration node. For deprecated settings, also display comments about deprecation. Include general config file preamble. Include local config file preamble. Where appropriate, add more spaces in output for better readability. Also display a comment containing the version of introduction for each configuration node. If the setting is deprecated, also display the version since which it is deprecated. The maximum number of outstanding writes that are allowed to devices in a RAID1 LV that is marked write-mostly. Once this value is exceeded, writes become synchronous (i.e. all writes to the constituent devices must complete before the array signals the write has completed). Setting the value to zero clears the preference and allows the system to choose the value arbitrarily. Mark a device in a RAID1 LV as write-mostly. All reads to these drives will be avoided unless absolutely necessary. This keeps the number of I/Os to the drive to a minimum. The default behavior is to set the write-mostly attribute for the specified PV. It is also possible to remove the write-mostly flag by adding the suffix \fB:n\fP at the end of the PV name, or to toggle the value with the suffix \fB:t\fP. Repeat this option to change the attribute on multiple PVs. #pvscan Auto-activate LVs in a VG when the PVs scanned have completed the VG. (Only \fBay\fP is applicable.) #lvchange #vgchange Change the active state of LVs. An active LV can be used through a block device, allowing data on the LV to be accessed. \fBy\fP makes LVs active, or available. \fBn\fP makes LVs inactive, or unavailable. The block device for the LV is added or removed from the system using device-mapper in the kernel. A symbolic link /dev/VGName/LVName pointing to the device node is also added/removed. All software and scripts should access the device through the symbolic link and present this as the name of the device. The location and name of the underlying device node may depend on the distribution, configuration (e.g. udev), or release version. \fBay\fP specifies autoactivation, which is used by system-generated activation commands. By default, LVs are autoactivated. An autoactivation property can be set on a VG or LV to disable autoactivation, see --setautoactivation y|n in vgchange, lvchange, vgcreate, and lvcreate. Display the property with vgs or lvs "-o autoactivation". The \fBlvm.conf\fP(5) auto_activation_volume_list includes names of VGs or LVs that should be autoactivated, and anything not listed is not autoactivated. When auto_activation_volume_list is undefined (the default), it has no effect. If auto_activation_volume_list is defined and empty, no LVs are autoactivated. Items included by auto_activation_volume_list will not be autoactivated if the autoactivation property has been disabled. See \fBlvmlockd\fP(8) for more information about activation options \fBey\fP and \fBsy\fP for shared VGs. #lvcreate Controls the active state of the new LV. \fBy\fP makes the LV active, or available. New LVs are made active by default. \fBn\fP makes the LV inactive, or unavailable, only when possible. In some cases, creating an LV requires it to be active. For example, COW snapshots of an active origin LV can only be created in the active state (this does not apply to thin snapshots). The --zero option normally requires the LV to be active. If autoactivation \fBay\fP is used, the LV is only activated if it matches an item in \fBlvm.conf\fP(5) \fBactivation/auto_activation_volume_list\fP. \fBay\fP implies --zero n and --wipesignatures n. See \fBlvmlockd\fP(8) for more information about activation options for shared VGs. #vgreduce Removes all empty PVs if none are named on the command line. #pvchange Change all visible PVs. #vgimport Import all visible VGs. #lvscan #lvdisplay #lvs Show information about internal LVs. These are components of normal LVs, such as mirrors, which are not independently accessible, e.g. not mountable. #vgs List all VGs. Equivalent to not specifying any VGs. #pvs #pvdisplay Show information about devices that have not been initialized by LVM, i.e. they are not PVs. Specifies if metadata should be backed up automatically after a change. Enabling this is strongly advised! See \fBvgcfgbackup\fP(8) for more information. Only select active VGs. The VG is considered active if at least one of its LVs is active. If the operation requires polling, this option causes the command to return before the operation is complete, and polling is done in the background. By default the snapshot VG will be renamed to the original name plus a numeric suffix to avoid duplicate naming (e.g. 'test_vg' would be renamed to 'test_vg1'). This option will override the base VG name that is used for all VG renames. If a VG already exists with the specified name a numeric suffix will be added (like the previous example) to make it unique. The size of chunks in a snapshot, cache pool or thin pool. For snapshots, the value must be a power of 2 between 4KiB and 512KiB and the default value is 4. For a cache pool the value must be between 32KiB and 1GiB and the default value is 64. For a thin pool the value must be between 64KiB and 1GiB and the default value starts with 64 and scales up to fit the pool metadata size within 128MiB, if the pool metadata size is not specified. The value must be a multiple of 64KiB. See \fBlvmthin\fP(7) and \fBlvmcache\fP(7) for more information. This option was specific to clvm and is now replaced by the --shared option with \fBlvmlockd\fP(8). Generate colon separated output for easier parsing in scripts or programs. Also see \fBvgs\fP(8) which provides considerably more control over the output. Display output in columns, the equivalent of \fBvgs\fP(8). Options listed are the same as options given in \fBvgs\fP(8). Sets or resets the contiguous allocation policy for LVs. Default is no contiguous allocation based on a next free principle. It is only possible to change a non-contiguous allocation policy to contiguous if all of the allocated physical extents in the LV are already contiguous. Set debug level. Repeat from 1 to 6 times to increase the detail of messages sent to the log file and/or syslog (if configured). Only show PVs belonging to exported VGs. #pvck Metadata file to read or write. #lvmconfig #dumpconfig #config Write output to the named file. #vgcfgbackup Write the backup to the named file. When backing up more than one VG, the file name is treated as a template, and %s is replaced by the VG name. #vgcfgrestore Read metadata backup from the named file. Usually this file was created by vgcfgbackup. Override various checks, confirmations and protections. Use with extreme caution. Specifies the command is handling a cache LV or cache pool. See --type cache and --type cache-pool. See \fBlvmcache\fP(7) for more information about LVM caching. Include historical LVs in the output. (This has no effect unless LVs were removed while \fBlvm.conf\fP(5) \fBmetadata/record_lvs_history\fP was enabled. Import exported VGs. Otherwise VGs that have been exported will not be changed (nor will their associated PVs). Report progress at regular intervals. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not change existing allocated space, but only applies to space being allocated by the command. When creating a RAID 4/5/6 LV, this number does not include the extra devices that are required for parity. The largest number depends on the RAID type (raid0: 64, raid10: 32, raid4/5: 63, raid6: 62), and when unspecified, the default depends on the RAID type (raid0: 2, raid10: 2, raid4/5: 3, raid6: 5.) To stripe a new raid LV across all PVs by default, see \fBlvm.conf\fP(5) \fBallocation/raid_stripe_all_devices\fP. The amount of data that is written to one device before moving to the next in a striped LV. Sets the maximum number of LVs allowed in a VG. #lvcreate Specifies the size of the new LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. #lvreduce #lvextend #lvresize Specifies the new size of the LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. #lvmconfig #dumpconfig #config List config settings with summarizing comment. This is the same as using options --typeconfig list --withsummary. #vgcfgrestore List metadata backup and archive files pertaining to the VG. May be used with --file. Does not restore the VG. #vgmerge Display merged destination VG like vgdisplay -v. #lvcreate Specifies the size of the new LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. #lvreduce #lvextend #lvresize Specifies the new size of the LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. When yes, makes the specified minor number persistent. #lvcreate #lvchange Sets the major number of an LV block device. #pvscan The major number of a device. Persistently sets (yes) or clears (no) the "activation skip" flag on an LV. An LV with this flag set is not activated unless the --ignoreactivationskip option is used by the activation command. This flag is set by default on new thin snapshot LVs. The flag is not applied to deactivation. The current value of the flag is indicated in the lvs lv_attr bits. Ignore the "activation skip" LV flag during activation to allow LVs with the flag set to be activated. #lvdisplay Display the mapping of logical extents to PVs and physical extents. To map physical extents to logical extents use: pvs --segments -o+lv_name,seg_start_pe,segtype #pvdisplay Display the mapping of physical extents to LVs and logical extents. #lvcreate Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. See the --nosync option for avoiding initial image synchronization. See \fBlvmraid\fP(7) for more information. #lvconvert Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. The plus prefix \fB+\fP can be used, in which case the number is added to the current number of images, or the minus prefix \fB-\fP can be used, in which case the number is subtracted from the current number of images. See \fBlvmraid\fP(7) for more information. #lvextend Not used. Specifies the type of on-disk metadata to use. \fBlvm2\fP (or just \fB2\fP) is the current, standard format. \fBlvm1\fP (or just \fB1\fP) is no longer used. #lvcreate #lvconvert Specifies the name of a new LV. When unspecified, a default name of "lvol#" is generated, where # is a number generated by LVM. #pvmove Move only the extents belonging to the named LV. #vgsplit Move only PVs used by the named LV. Do not perform fsck before resizing filesystem when filesystem requires it. You may need to use --force to proceed with this option. Only show PVs not belonging to any VG. Comma-separated, ordered list of fields to display in columns. String arg syntax is: [\fB+\fP|\fB-\fP|\fB#\fP]\fIField1\fP[\fB,\fP\fIField2\fP ...] The prefix \fB+\fP will append the specified fields to the default fields, \fB-\fP will remove the specified fields from the default fields, and \fB#\fP will compact specified fields (removing them when empty for all rows.) Use \fB-o help\fP to view the list of all available fields. Use separate lists of fields to add, remove or compact by repeating the -o option: -o+field1,field2 -o-field3,field4 -o#field5. These lists are evaluated from left to right. Use field name \fBlv_all\fP to view all LV fields, \fBvg_all\fP all VG fields, \fBpv_all\fP all PV fields, \fBpvseg_all\fP all PV segment fields, \fBseg_all\fP all LV segment fields, and \fBpvseg_all\fP all PV segment columns. See the \fBlvm.conf\fP(5) report section for more config options. See \fBlvmreport\fP(7) for more information about reporting. Comma-separated ordered list of columns to sort by. Replaces the default selection. Precede any column with \fB-\fP for a reverse sort on that column. Sets the maximum number of PVs that can belong to the VG. The value 0 removes any limitation. For large numbers of PVs, also see options --pvmetadatacopies, and --vgmetadatacopies for improving performance. Set access permission to read only \fBr\fP or read and write \fBrw\fP. Commands will do their best to activate LVs with missing PV extents. Missing extents may be replaced with error or zero segments according to the missing_stripe_filler setting. Metadata may not be changed with this option. Suppress output and log messages. Overrides --debug and --verbose. Repeat once to also suppress any prompts with answer 'no'. Sets read ahead sector count of an LV. \fBauto\fP is the default which allows the kernel to choose a suitable value automatically. \fBnone\fP is equivalent to zero. Resize underlying filesystem together with the LV using \fBfsadm\fP(8). Size of each raid or mirror synchronization region. \fBlvm.conf\fP(5) \fBactivation/raid_region_size\fP can be used to configure a default. #vgcreate Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. #vgchange Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. Before increasing the physical extent size, you might need to use lvresize, pvresize and/or pvmove so that everything fits. For example, every contiguous range of extents used in a LV must start and end on an extent boundary. #lvcreate Create a snapshot. Snapshots provide a "frozen image" of an origin LV. The snapshot LV can be used, e.g. for backups, while the origin LV continues to be used. This option can create a COW (copy on write) snapshot, or a thin snapshot (in a thin pool.) Thin snapshots are created when the origin is a thin LV and the size option is NOT specified. Thin snapshots share the same blocks in the thin pool, and do not allocate new space from the VG. Thin snapshots are created with the "activation skip" flag, see --setactivationskip. A thin snapshot of a non-thin "external origin" LV is created when a thin pool is specified. Unprovisioned blocks in the thin snapshot LV are read from the external origin LV. The external origin LV must be read-only. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. COW snapshots are created when a size is specified. The size is allocated from space in the VG, and is the amount of space that can be used for saving COW blocks as writes occur to the origin or snapshot. The size chosen should depend upon the amount of writes that are expected; often 20% of the origin LV is enough. If COW space runs low, it can be extended with lvextend (shrinking is also allowed with lvreduce.) A small amount of the COW snapshot LV size is used to track COW block locations, so the full size is not available for COW data blocks. Use lvs to check how much space is used, and see --monitor to to automatically extend the size to avoid running out of space. #lvconvert Combine a former COW snapshot LV with a former origin LV to reverse a previous --splitsnapshot command. #pvdisplay Only display the size of the given PVs. #vgdisplay Give a short listing showing the existence of VGs. #pvscan Short listing format. Select objects for processing and reporting based on specified criteria. The criteria syntax is described by \fB--select help\fP and \fBlvmreport\fP(7). For reporting commands, one row is displayed for each object matching the criteria. See \fB--options help\fP for selectable object fields. Rows can be displayed with an additional "selected" field (-o selected) showing 1 if the row matches the selection and 0 otherwise. For non-reporting commands which process LVM entities, the selection is used to choose items to process. Run in test mode. Commands will not update metadata. This is implemented by disabling all metadata writing but nevertheless returning success to the calling function. This may lead to unusual error messages in multi-stage operations if a tool relies on reading back metadata it believes has changed but hasn't. Specifies the command is handling a thin LV or thin pool. See --type thin, --type thin-pool, and --virtualsize. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Update VG metadata to correct problems. If VG metadata was updated while a PV was missing, and the PV reappears with an old version of metadata, then this option (or any other command that writes metadata) will update the metadata on the previously missing PV. If a PV was removed from a VG while it was missing, and the PV reappears, using this option will clear the outdated metadata from the previously missing PV. If metadata text is damaged on one PV, using this option will replace the damaged metadata text. For more severe damage, e.g. with headers, see \fBpvck\fP(8). #pvchange Generate new random UUID for specified PVs. #pvscan Show UUIDs in addition to device names. #vgchange Generate new random UUID for specified VGs. Specify a UUID for the device. Without this option, a random UUID is generated. This option is needed before restoring a backup of LVM metadata onto a replacement device; see \fBvgcfgrestore\fP(8). As such, use of --restorefile is compulsory unless the --norestorefile is used. All PVs must have unique UUIDs, and LVM will prevent certain operations if multiple devices are seen with the same UUID. See \fBvgimportclone\fP(8) for more information. Set verbose level. Repeat from 1 to 4 times to increase the detail of messages sent to stdout and stderr. The virtual size of a new thin LV. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Using virtual size (-V) and actual size (-L) together creates a sparse LV. \fBlvm.conf\fP(5) \fBglobal/sparse_segtype_default\fP determines the default segment type used to create a sparse LV. Anything written to a sparse LV will be returned when reading from it. Reading from other areas of the LV will return blocks of zeros. When using a snapshot to create a sparse LV, a hidden virtual device is created using the zero target, and the LV has the suffix _vorigin. Snapshots are less efficient than thin provisioning when creating large sparse LVs (GiB). Controls detection and subsequent wiping of signatures on new LVs. There is a prompt for each signature detected to confirm its wiping (unless --yes is used to override confirmations.) When not specified, signatures are wiped whenever zeroing is done (see --zero). This behaviour can be configured with \fBlvm.conf\fP(5) \fBallocation/wipe_signatures_when_zeroing_new_lvs\fP. If blkid wiping is used (\fBlvm.conf\fP(5) \fBallocation/use_blkid_wiping\fP) and LVM is compiled with blkid wiping support, then the blkid(8) library is used to detect the signatures (use blkid -k to list the signatures that are recognized). Otherwise, native LVM code is used to detect signatures (only MD RAID, swap and LUKS signatures are detected in this case.) The LV is not wiped if the read only flag is set. Enable or disable allocation of physical extents on this PV. Enables or disables the addition or removal of PVs to/from a VG (by vgextend/vgreduce). Do not prompt for confirmation interactively but always assume the answer yes. Use with extreme caution. (For automatic no, see -qq.) #lvchange Set zeroing mode for thin pool. Note: already provisioned blocks from pool in non-zero mode are not cleared in unwritten parts when setting --zero y. #lvconvert For snapshots, this controls zeroing of the first 4KiB of data in the snapshot. If the LV is read-only, the snapshot will not be zeroed. For thin pools, this controls zeroing of provisioned blocks. Provisioning of large zeroed chunks negatively impacts performance. #lvcreate Controls zeroing of the first 4KiB of data in the new LV. Default is \fBy\fP. Snapshot COW volumes are always zeroed. For thin pools, this controls zeroing of provisioned blocks. LV is not zeroed if the read only flag is set. Warning: trying to mount an unzeroed LV can cause the system to hang. #pvcreate #vgcreate #vgextend Controls if the first 4 sectors (2048 bytes) of the device are wiped. The default is to wipe these sectors unless either or both of --restorefile or --uuid are specified. writethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_searchP@OO_ALL: --commandprofile String, --config String, --debug, --driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet, --verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal String OO_REPORT: --aligned, --all, --binary, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --nameprefixes, --noheadings, --nosuffix, --options String, --readonly, --reportformat ReportFmt, --rows, --select String, --separator String, --shared, --sort String, --unbuffered, --units Units, --unquoted OO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced, --ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String, --sinceversion String, --showdeprecated, --showunsupported, --validate, --withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces, --unconfigured, --withversions OO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String OO_LVCHANGE_META: --addtag Tag, --deltag Tag, --alloc Alloc, --contiguous Bool, --compression Bool, --deduplication Bool, --detachprofile, --metadataprofile String, --profile String, --permission Permission, --readahead Readahead, --setactivationskip Bool, --setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --vdosettings String, --writebehind Number, --writemostly WriteMostlyPV, --persistent n lvchange OO_LVCHANGE_META VG|LV|Tag|Select ... OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_properties DESC: Change a general LV attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_image RULE: all and lv_is_vg_writable RULE: --contiguous not --alloc RULE: --profile not --detachprofile RULE: --metadataprofile not --detachprofile RULE: --minrecoveryrate --maxrecoveryrate and LV_raid RULE: --writebehind --writemostly and LV_raid1 RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecache RULE: --errorwhenfull --discards --zero and LV_thinpool RULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpool RULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_origin RULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partial lvchange --resync VG|LV_raid_mirror|Tag|Select ... OO: --activate Active, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_resync DESC: Resyncronize a mirror or raid LV. DESC: Use to reset 'R' attribute on a not initially synchronized LV. RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrity RULE: all not LV_raid0 lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_syncaction DESC: Resynchronize or check a raid LV. RULE: all not LV_raid0 lvchange --rebuild PV VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_rebuild DESC: Reconstruct data on specific PVs of a raid LV. RULE: all not LV_raid0 lvchange --activate Active VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, --ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_activate DESC: Activate or deactivate an LV. lvchange --refresh VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_refresh DESC: Reactivate an LV using the latest metadata. lvchange --monitor Bool VG|LV|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_monitor DESC: Start or stop monitoring an LV from dmeventd. RULE: all not lv_is_pvmove lvchange --poll Bool VG|LV|Tag|Select ... OO: --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_poll DESC: Start or stop processing an LV conversion. lvchange --persistent y --minor Number LV OO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_persistent DESC: Make the minor device number persistent for an LV. RULE: all not LV_thinpool LV_cachepool LV_vdopool OO_LVCONVERT_POOL: --poolmetadata LV, --poolmetadatasize SizeMB, --poolmetadataspare Bool, --readahead Readahead, --chunksize SizeKB, --zero Bool, --metadataprofile String OO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --zero Bool OO_LVCONVERT_VDO: --metadataprofile String, --readahead Readahead, --compression Bool, --deduplication Bool, --vdosettings String, --zero Bool OO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsync lvconvert --type linear LV OO: OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to linear. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type striped LV OO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to striped. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type mirror LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to type mirror (also see type raid1), RULE: all not lv_is_locked lv_is_pvmove lvconvert --type raid LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid or change raid layout DESC: (a specific raid level must be used, e.g. raid1). RULE: all not lv_is_locked lv_is_pvmove RULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --interval lvconvert --mirrors SNumber LV OO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid1 or mirror, or change number of mirror images. RULE: all not lv_is_locked lv_is_pvmove lvconvert --stripes_long Number LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKB OP: PV ... ID: lvconvert_raid_types DESC: Convert raid LV to change number of stripe images. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --stripesize SizeKB LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize ID: lvconvert_raid_types DESC: Convert raid LV to change the stripe size. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --regionsize RegionSize LV_raid OO: OO_LVCONVERT ID: lvconvert_change_region_size DESC: Change the region size of an LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 FLAGS: SECONDARY_SYNTAX lvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 or mirror LV and use them to create a new LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --splitmirrors Number --trackchanges LV_raid1_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 LV and track changes to origin for later merge. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --mergemirrors LV_linear_raid|VG|Tag ... OO: OO_LVCONVERT ID: lvconvert_merge_mirror_images DESC: Merge LV images that were split from a raid1 LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integrity lvconvert --mirrorlog MirrorLog LV_mirror OO: OO_LVCONVERT OP: PV ... ID: lvconvert_change_mirrorlog DESC: Change the type of mirror log used by a mirror LV. RULE: all not lv_is_locked lv_is_pvmove FLAGS: SECONDARY_SYNTAX lvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_to_writecache DESC: Attach a writecache to an LV, converts the LV to type writecache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpool OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --cache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX lvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String ID: lvconvert_to_writecache_with_device DESC: Add a writecache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKB ID: lvconvert_to_cache_with_device DESC: Add a cache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_error_zero OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool DESC: Convert LV to type thin-pool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thinpool LV_linear_striped_raid_cache_writecache_thinpool OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool_or_swap_metadata DESC: Convert LV to type thin-pool (variant, use --type thin-pool). DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long AUTOTYPE: thin-pool lvconvert --type cache-pool LV_linear_striped_raid OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool DESC: Convert LV to type cache-pool. RULE: --poolmetadata not --readahead --stripesize --stripes_long RULE: all not lv_is_raid_with_integrity lvconvert --cachepool LV_linear_striped_raid_cachepool_error_zero OO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool_or_swap_metadata DESC: Convert LV to type cache-pool (variant, use --type cache-pool). DESC: Swap metadata LV in a cache pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type vdo-pool LV_linear_striped_raid_cache OO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO, OO_LVCONVERT ID: lvconvert_to_vdopool DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity lvconvert --vdopool LV_linear_striped_raid_cache OO: OO_LVCONVERT_VDO, OO_LVCONVERT, --name LV_new, --virtualsize SizeMB, ID: lvconvert_to_vdopool_param DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo-pool lvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_keep_cache DESC: Detach a cache from an LV. lvconvert --uncache LV_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_remove_cache DESC: Detach and delete a cache from an LV. FLAGS: SECONDARY_SYNTAX lvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepool OO: --chunksize SizeKB, OO_LVCONVERT ID: lvconvert_swap_pool_metadata DESC: Swap metadata LV in a thin pool or cache pool (for repair only). FLAGS: SECONDARY_SYNTAX lvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge DESC: Merge LV that was split from a mirror (variant, use --mergemirrors). DESC: Merge thin LV into its origin LV (variant, use --mergethin). DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot). RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --mergethin LV_thin ... OO: OO_LVCONVERT ID: lvconvert_merge_thin DESC: Merge thin LV into its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --mergesnapshot LV_snapshot ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge_snapshot DESC: Merge COW snapshot LV into its origin. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --splitsnapshot LV_snapshot OO: OO_LVCONVERT ID: lvconvert_split_cow_snapshot DESC: Separate a COW snapshot from its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --type snapshot LV LV_linear_striped OO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible lvconvert --snapshot LV LV_linear_striped OO: --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible FLAGS: SECONDARY_SYNTAX AUTOTYPE: snapshot lvconvert --repair LV_cache_cachepool_mirror_raid_thinpool OO: --usepolicies, --interval Number, --poolmetadataspare Bool, OO_LVCONVERT OP: PV ... ID: lvconvert_repair DESC: Replace failed PVs in a raid or mirror LV. DESC: Repair a thin pool. DESC: Repair a cache pool. RULE: all not lv_is_locked lv_is_pvmove RULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpool lvconvert --replace PV LV_raid OO: OO_LVCONVERT OP: PV ... ID: lvconvert_replace_pv DESC: Replace specific PV(s) in a raid LV with another PV. RULE: all not lv_is_locked lv_is_pvmove lvconvert --startpoll LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_start_poll DESC: Poll LV to continue conversion. RULE: all and lv_is_converting lvconvert LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_plain DESC: Poll LV to continue conversion (also see --startpoll) DESC: or waits till conversion/mirror syncing is finished FLAGS: SECONDARY_SYNTAX lvconvert --raidintegrity Bool LV_raid OO: --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCONVERT OP: PV ... ID: lvconvert_integrity DESC: Add or remove data integrity checksums to raid images. OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active, --contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number, --metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync, --noudevsync, --permission Permission, --persistent Bool, --readahead Readahead, --reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool, --zero Bool, --setautoactivation Bool OO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String, --chunksize SizeKB, --cachemetadataformat CacheMetadataFormat OO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKB OO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings String lvcreate --type error --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_error_vol DESC: Create an LV that returns errors when used. FLAGS: SECONDARY_SYNTAX lvcreate --type zero --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_zero_vol DESC: Create an LV that returns zeros when read. FLAGS: SECONDARY_SYNTAX lvcreate --type linear --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. FLAGS: SECONDARY_SYNTAX lvcreate --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. AUTOTYPE: linear lvcreate --type striped --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV (also see lvcreate --stripes). FLAGS: SECONDARY_SYNTAX lvcreate --stripes Number --size SizeMB VG OO: --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV. AUTOTYPE: striped lvcreate --type mirror --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATE OP: PV ... ID: lvcreate_mirror DESC: Create a mirror LV (also see --type raid1). FLAGS: SECONDARY_SYNTAX lvcreate --mirrors PNumber --size SizeMB VG OO: --stripesize SizeKB, --mirrorlog MirrorLog, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... IO: --stripes 1 ID: lvcreate_mirror_or_raid1 DESC: Create a raid1 or mirror LV. AUTOTYPE: raid1 AUTOTYPE: mirror lvcreate --type raid --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid LV (a specific raid level must be used, e.g. raid1). lvcreate --mirrors PNumber --stripes Number --size SizeMB VG OO: --stripesize SizeKB, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid10 LV. AUTOTYPE: raid10 lvcreate --type snapshot --size SizeMB LV OO: --snapshot, --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --snapshot --size SizeMB LV OO: --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV. AUTOTYPE: snapshot lvcreate --type snapshot --size SizeMB --virtualsize SizeMB VG OO: --snapshot, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot_with_virtual_origin DESC: Create a sparse COW snapshot LV of a virtual origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --type thin-pool --size SizeMB VG OO: --thinpool LV_new, --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. lvcreate --thin --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool named in --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --type cache-pool --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool. lvcreate --type cache-pool --size SizeMB --cachepool LV_new VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool named by the --cachepool arg DESC: (variant, uses --cachepool in place of --name). FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool named in the first arg DESC: (variant, also see --thinpool for naming pool). FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. AUTOTYPE: thin lvcreate --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in the thin pool named in the first arg DESC: (also see --thinpool for naming pool.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin LV_thin OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX lvcreate --thin LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --snapshot LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. AUTOTYPE: thin lvcreate --type thin --thinpool LV_thinpool LV OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. lvcreate --snapshot --thinpool LV_thinpool LV OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a LV that returns VDO when used. lvcreate --vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --vdopool LV_new --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by the --thinpool arg. FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX lvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --size SizeMB --virtualsize SizeMB VG OO: --stripes Number, --stripesize SizeKB, --snapshot, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshot DESC: Create a thin LV, first creating a thin pool for it. DESC: Create a sparse snapshot of a virtual origin LV DESC: Chooses type thin or snapshot according to DESC: config setting sparse_segtype_default. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin AUTOTYPE: snapshot lvcreate --type cache --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. lvcreate --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v2 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB LV_cachepool OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v3 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. DESC: (variant, also use --cachepool). FLAGS: SECONDARY_SYNTAX lvcreate --cache --size SizeMB LV OO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool DESC: When the LV arg is a cachepool, then create a new LV and DESC: attach the cachepool arg to it. DESC: (variant, use --type cache and --cachepool.) DESC: When the LV arg is not a cachepool, then create a new cachepool DESC: and attach it to the LV arg (alternative, use lvconvert.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB --cachevol LV VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachevol_for_cache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type cache. lvcreate --type cache --size SizeMB --cachedevice PV VG OO: --stripes Number, --stripesize SizeKB, --cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachedevice_for_cache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type cache. lvcreate --type writecache --size SizeMB --cachevol LV VG OO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachevol_for_writecache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type writecache. lvcreate --type writecache --size SizeMB --cachedevice PV VG OO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachedevice_for_writecache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type writecache. lvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --history, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --sort String, --readonly, --segments, --select String, --separator String, --shared, --unbuffered, --units Units OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: lvdisplay_general lvextend --size PSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvextend_by_size DESC: Extend an LV by a specified size. lvextend LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvextend_by_pv DESC: Extend an LV by specified PV extents. lvextend --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvextend_pool_metadata_by_size DESC: Extend a pool metadata SubLV by a specified size. lvextend --usepolicies LV_thinpool_snapshot OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --type SegType OP: PV ... ID: lvextend_by_policy DESC: Extend an LV according to a predefined policy. lvmconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general lvmdevices ID: lvmdevices_list DESC: Print devices in the devices file. lvmdevices --check ID: lvmdevices_check DESC: Check the devices file and report incorrect values. lvmdevices --update ID: lvmdevices_update DESC: Update the devices file to fix incorrect values. lvmdevices --adddev PV OO: --deviceidtype String ID: lvmdevices_edit DESC: Add a device to the devices file. lvmdevices --deldev PV ID: lvmdevices_edit DESC: Remove a device from the devices file. lvmdevices --addpvid String OO: --deviceidtype String ID: lvmdevices_edit DESC: Find the device with the given PVID and add it to the devices file. lvmdevices --delpvid String ID: lvmdevices_edit DESC: Remove the devices file entry for the given PVID. lvreduce --size NSizeMB LV OO: --autobackup Bool, --force, --nofsck, --noudevsync, --reportformat ReportFmt, --resizefs ID: lvreduce_general lvremove VG|LV|Tag|Select ... OO: --autobackup Bool, --force, --nohistory, --noudevsync, --reportformat ReportFmt, --select String ID: lvremove_general lvrename VG LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_vg_lv_lv lvrename LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_lv_lv lvresize --size SSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvresize_by_size DESC: Resize an LV by a specified size. lvresize LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvresize_by_pv DESC: Resize an LV by specified PV extents. lvresize --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvresize_pool_metadata_by_size DESC: Resize a pool metadata SubLV by a specified size. lvs OO: --history, --segments, OO_REPORT OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: lvs_general lvscan OO: --all, --blockdevice, --ignorelockingfailure, --readonly, --reportformat ReportFmt IO: --partial, --cache_long ID: lvscan_general OO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmt, --uuid OO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag, --uuid, --metadataignore Bool pvchange --all OO_PVCHANGE_META OO: OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_all DESC: Change properties of all PVs. pvchange OO_PVCHANGE_META PV|Select ... OO: --select String, OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_some DESC: Change properties of specified PVs. pvresize PV ... OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmt ID: pvresize_general pvck PV ... OO: --labelsector Number ID: pvck_general DESC: Check for metadata on a device pvck --dump DumpType PV OO: --settings String, --file String, --pvmetadatacopies MetadataCopiesPV, --labelsector Number ID: pvck_dump DESC: Check and print LVM headers and metadata on a device pvck --repairtype RepairType PV OO: --settings String, --file String, --labelsector Number ID: pvck_repair_type DESC: Repair LVM headers or metadata on a device pvck --repair --file String PV OO: --settings String, --labelsector Number ID: pvck_repair DESC: Repair LVM headers and metadata on a device pvcreate PV ... OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB, --force, --labelsector Number, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB, --reportformat ReportFmt, --restorefile String, --uuidstr String, --zero Bool ID: pvcreate_general RULE: --norestorefile not --restorefile RULE: --bootloaderareasize not --restorefile pvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --readonly, --select String, --separator String, --shared, --short, --sort String, --unbuffered, --units Units OP: PV|Tag ... IO: --ignoreskippedcluster, --reportformat ReportFmt ID: pvdisplay_general pvmove PV OO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background, --interval Number, --name LV, --noudevsync, --reportformat ReportFmt OP: PV ... ID: pvmove_one DESC: Move PV extents. pvmove OO: --abort, --background, --interval Number ID: pvmove_any DESC: Continue or abort existing pvmove operations. pvremove PV ... OO: --force, --reportformat ReportFmt ID: pvremove_general pvs OO: --segments, OO_REPORT OP: PV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: pvs_general pvscan OO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup, --short, --uuid ID: pvscan_display DESC: Display PV information. pvscan --cache_long OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online or offline. pvscan --cache_long --activate ay OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online and autoactivate the VG if complete. pvscan --cache_long --listvg PV OO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput ID: pvscan_cache DESC: Record that a PV is online and list the VG using the PV. pvscan --cache_long --listlvs PV OO: --ignorelockingfailure, --checkcomplete, --vgonline ID: pvscan_cache DESC: Record that a PV is online and list LVs using the PV. pvscan --listlvs PV ID: pvscan_cache DESC: List LVs using the PV. pvscan --listvg PV ID: pvscan_cache DESC: List the VG using the PV. vgcfgbackup OO: --file String, --foreign, --ignorelockingfailure, --readonly, --reportformat ReportFmt OP: VG ... IO: --partial ID: vgcfgbackup_general OO_VGCFGRESTORE: --force_long, --metadatatype MetadataType vgcfgrestore VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_vg DESC: Restore VG metadata from last backup. vgcfgrestore --file String VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_file DESC: Restore VG metadata from specified file. vgcfgrestore --list VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_list_by_vg DESC: List all VG metadata backups. vgcfgrestore --list --file String OO: OO_VGCFGRESTORE OP: VG ID: vgcfgrestore_list_by_file DESC: List one VG metadata backup file. OO_VGCHANGE: --autobackup Bool, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String, --force OO_VGCHANGE_META: --addtag Tag, --deltag Tag, --logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --physicalextentsize SizeMB, --resizeable Bool, --profile String, --detachprofile, --metadataprofile String, --setautoactivation Bool vgchange OO_VGCHANGE_META OO: --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_properties DESC: Change a general VG attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. vgchange --monitor Bool OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_monitor DESC: Start or stop monitoring LVs from dmeventd. vgchange --poll Bool OO: --ignorelockingfailure, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_poll DESC: Start or stop processing LV conversions. vgchange --activate Active OO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit, --readonly, --ignorelockingfailure, --monitor Bool, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_activate DESC: Activate or deactivate LVs. vgchange --refresh OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_refresh DESC: Reactivate LVs using the latest metadata. vgchange --systemid String VG ID: vgchange_systemid DESC: Change the system ID of a VG. vgchange --lockstart OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstart DESC: Start the lockspace of a shared VG in lvmlockd. vgchange --lockstop OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstop DESC: Stop the lockspace of a shared VG in lvmlockd. vgchange --locktype LockType VG ID: vgchange_locktype DESC: Change the lock type for a shared VG. vgck OO: --reportformat ReportFmt OP: VG|Tag ... ID: vgck_general DESC: Read and display information about a VG. vgck --updatemetadata VG ID: vgck_update_metadata DESC: Rewrite VG metadata to correct problems. vgcreate VG_new PV ... OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType, --physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --shared, --systemid String, --locktype LockType, --setautoactivation Bool ID: vgcreate_general vgdisplay OO: --activevolumegroups, --aligned, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --noheadings, --nosuffix, --options String, --readonly, --select String, --shared, --short, --separator String, --sort String, --unbuffered, --units Units OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: vgdisplay_general OO_VGEXPORT: --reportformat ReportFmt vgexport VG|Tag|Select ... OO: --select String, OO_VGEXPORT ID: vgexport_some DESC: Export specified VGs. vgexport --all OO: OO_VGEXPORT ID: vgexport_all DESC: Export all VGs. vgextend VG PV ... OO: --autobackup Bool, --force, --zero Bool, --labelsector Number, --metadatatype MetadataType, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --reportformat ReportFmt, --restoremissing ID: vgextend_general OO_VGIMPORT: --force, --reportformat ReportFmt vgimport VG|Tag|Select ... OO: --select String, OO_VGIMPORT ID: vgimport_some DESC: Import specified VGs. vgimport --all OO: OO_VGIMPORT ID: vgimport_all DESC: Import all VGs. vgimportclone PV ... OO: --basevgname VG, --import, --importdevices ID: vgimportclone_general vgimportdevices VG|Tag|Select ... OO: --select String, --foreign, --reportformat ReportFmt ID: vgimportdevices_some DESC: Add devices from specific VGs to the devices file. vgimportdevices --all OO: --foreign, --reportformat ReportFmt ID: vgimportdevices_all DESC: Add devices from all accessible VGs to the devices file. vgmerge VG VG OO: --autobackup Bool, --list, --poolmetadataspare Bool ID: vgmerge_general vgmknodes OO: --ignorelockingfailure, --refresh, --reportformat ReportFmt OP: VG|LV|Tag ... ID: vgmknodes_general OO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmt vgreduce VG PV ... OO: OO_VGREDUCE ID: vgreduce_by_pv DESC: Remove a PV from a VG. vgreduce --all VG OO: OO_VGREDUCE ID: vgreduce_all DESC: Remove all unused PVs from a VG. vgreduce --removemissing VG OO: --mirrorsonly, OO_VGREDUCE ID: vgreduce_missing DESC: Remove all missing PVs from a VG. vgremove VG|Tag|Select ... OO: --force, --noudevsync, --reportformat ReportFmt, --select String ID: vgremove_general vgrename VG VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_name DESC: Rename a VG. vgrename String VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_uuid DESC: Rename a VG by specifying the VG UUID. vgs OO: OO_REPORT OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: vgs_general vgscan OO: --ignorelockingfailure, --mknodes, --notifydbus, --reportformat ReportFmt IO: --partial, --cache_long ID: vgscan_general OO_VGSPLIT: --autobackup Bool, --poolmetadataspare Bool OO_VGSPLIT_NEW: --alloc Alloc, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVG vgsplit VG VG PV ... OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_pv DESC: Split a VG by specified PVs. vgsplit --name LV VG VG OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_lv DESC: Split a VG by PVs in a specified LV. config OO: OO_CONFIG OP: String ... ID: lvmconfig_general dumpconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general devtypes OO: --aligned, --binary, --nameprefixes, --noheadings, --nosuffix, --options String, --reportformat ReportFmt, --rows, --select String, --separator String, --sort String, --unbuffered, --unquoted ID: devtypes_general fullreport OO: OO_REPORT OP: VG ... IO: --partial, --ignoreskippedcluster, --trustcache ID: fullreport_general lastlog OO: --reportformat ReportFmt, --select String ID: lastlog_general lvpoll --polloperation PollOp LV ... OO: --abort, --autobackup Bool, --handlemissingpvs, --interval Number ID: lvpoll_general formats ID: formats_general help OP: String ... ID: help_general version ID: version_general pvdata ID: pvdata_general segtypes ID: segtypes_general systemid ID: systemid_general tags ID: tags_general lvmchange ID: lvmchange_general lvmdiskscan OO: --lvmpartition, --readonly ID: lvmdiskscan_general lvmsadc ID: lvmsadc_general lvmsar OO: --full, --stdin ID: lvmsar_general vgconvert VG ... OO: --force, --labelsector Number, --bootloaderareasize SizeMB, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --reportformat ReportFmt ID: vgconvert_general *dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataOnly one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.lvchange.c and %u other snapshot(s)Failed to prepare message.%s device number not changed.Cannot deactivate %s.%s: reactivation failed.(inherited)%s:yLogical volume %s changed.No settings changed.Polling LV %sMonitoring LV %sUnmonitoring LV %sdisk-logged core-logged clustered Failed to clear %s %s for %s.intermediateNo --rebuild found!Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Operation not permitted on hidden LV %s.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Minor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for %s.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.Logical volume %s is not active.Refreshing logical volume %s (if active).Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.WARNING: Combining activation change with other commands is not advised.Cannot change LV properties when activating component LVs.Internal error: Missing function for command definition %d:%s.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Thin repair commnand is not configured. Repair is disabled.Failed to build thin metadata path.Failed to build pool metadata spare path.Internal error: Unable to find configuration for global/thin_repair_optionsInvalid string in config file: global/thin_repair_optionsToo many options for thin repair command.Active pools cannot be repaired. Use lvchange -an first.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Can't prepare new metadata name for %s.Can't generate new name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.Cache repair commnand is not configured. Repair is disabled.Failed to build cache metadata path.Internal error: Unable to find configuration for global/cache_repair_optionsInvalid string in config file: global/cache_repair_optionsToo many options for cache repair command.Only inactive cache can be repaired.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Failed to get '--replace' argumentUnable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)Do you really want to convert %s? [y/n]: Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.Operation not permitted on LV %s type %s.Unable to swap pool metadata in VG with lock_type %sCan't use same LV for pool data and metadata LV %s.LV %s with type %s cannot be used as a metadata LV.Pool metadata LV %s is of an unsupported type.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Aborting. Failed to deactivate %s.%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?Unable to convert VDO pool in VG with lock_type %sAborting. Failed to wipe VDO data store.Converted %s to VDO pool volume and created virtual %s VDO volume.WARNING: Converting logical volume %s to VDO pool volume %s formating.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Test mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Internal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.Convert poll ID list allocation failed.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.Internal error: LV %s is already a pool.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Aborting. Failed to deactivate metadata lv. Manual intervention required.Aborting. Failed to deactivate logical volume %s.Failed to activate pool logical volume %s.Failed to deactivate pool data logical volume %s.Failed to deactivate pool metadata logical volume %s.Failed to unlock pool data LV %s/%sFailed to unlock pool metadata LV %s/%sWARNING: Converting %s to %s pool's data%s %s metadata wiping.Pool metadata extents %u chunk_size %uInternal error: Invalid lvconvert pool commandInternal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.LV %s with type %s cannot be converted to a cache pool.LV %s is already used as a cachevol.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Internal error: LV %s is not a cache pool data volume.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.Redirecting operation to data sub LV %s.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Aborting. Unable to deactivate new LV. Manual intervention required.Converted %s to thin volume with external origin %s.Unable to deactivate failed new LV. Manual intervention required.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Internal error: LV %s is not a thin pool.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.Cannot add integrity while LV is missing PVs.Logical volume %s has added integrity.Logical volume %s has removed integrity.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.No cachedevice specified to create a cachevol.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.Erase all existing data on %s? [y/n]: Can't prepare new cachevol name for %s.Failed to unlock fast LV %s/%sCannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set cleaner cachesetting to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.Cannot convert %s LV %s to %s.Cannot specify mirrors with linear type.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesOnly up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to sync local dev names.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: Cannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Conversion starts after activation.Merging of snapshot %s will occur on next activation of %s.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearFailed to allocate poll identifier for lvconvert.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Volume %s is consistent. Nothing to repair.Failed to initialize processing handle.Internal error: Unknown pool conversion.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.lvconvert.c-i-otransaction="%s_meta%%dManual repair required._mimagetmp_%dlayer name creation failed.Failed to insert resync layerConversion aborted.WARNING: %s not zeroed.Metadata LV %s not found.Can't convert locked LV %s.pvmove_tmetaVolume %s replaced origin %s.Cannot activate %s.withWITHOUTMergedConvertedLogical volume %s not split.Unknown pool metadata LV %s.Creation of pool LV failed.Failed to lock pool LV %s.Converted %s to %s pool. and metadata volumes and Cache pool %s not found.Thin pool %s not found.LV does not have integrity.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolCannot find cache %s.Invalid writecache settings.Invalid cachevol LV.MemTotal:%*s%llu%*sLV %s could not be zeroed._wcorigMerging of volume %s started.Setting logging type to %s.Logical volume %s converted.Cannot convert LV %s.No usable images left in %s.LVM_VG_NAMEvg/lv string alloc failed.Failed to remove temporary sync layer.Failed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.lvconvert_poll.cpmove_tmeta%s: %s: %s%%LV %s is not merged.skipped from activation inactive auto activated read-only origin %s%s%s%s%s%s%slvcreate.cis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsmay not be negativemay not be zeroSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.Failed to get tag.is only available with pools, %ORIGINwith generated name as snapshot of Failed to remove new LV %s.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Inconsistent volume group names given: "%s" and "%s"Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.Dropping VDO pool header size to 0 to support maximal size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Cannot use stripes with linear type.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambigous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Ambiguous syntax, please create --type cache-pool %s separately.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Maximal supported VDO virtual size is %s.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Can't use %s size. Maximal supported VDO POOL volume size with slab size %s is %s.Using maximal supported VDO POOL volume size %s (with slab size %s).Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sNo space for sanlock lock, extend the internal lvmlock LV.Making thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.Removal of created spare volume failed. Manual intervention required.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.MLH|HTLMMLHdHT4MIncompatible options selectedlvdisplay.cIncompatible options selected.Options -c and -m are incompatible.%s: no such command.lvmcmdline.c%s - %s -Unrecognised option %d (%c).Option requires argument.Invalid argument for %s: %s/proc/%u/cmdline/proc/self/fd/%u Parent PID %d: %s FFRSpecified %%%s is unknown.%s: invalid file descriptor.kmgtpebsSize is too big (>=16EiB).Can't parse size argument.stub.hOption %s %s.yesyyalnylSize may not be negative.Size may not be positive.Number may not be negative.Extents may not be negative.Extents may not be positive.wrRegion size may not be zero.pvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawsystem ID: %sLVM version: %sLibrary version: %sDriver version: %sConfiguration: %sAvailable lvm commands:%-16.16s%sTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sIgnore opt %dInvalid devices file name.Invalid units specificationProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedskiplvskipvgskipglCompleted: %sLVM_LVMLOCKD_SOCKETToo many arguments: %squitexitlvm.staticinitrd-lvmstdin stream openstdin stream open: %s stdout stream openstderr stream open: %s LVM_OUT_FDLVM_ERR_FDLVM_REPORT_FDLVM_SUPPRESS_FD_WARNINGSRLIMIT_NOFILEgetrlimit/usr/sbin/lvmLVM_DID_EXECunsetenv-h-?Command definition index %d enum %d id %sInternal error: Command %s not found.Use --longhelp to show all options and advanced commands.Unable to allocate memory for command line arguments.Option%s%c%s%s may not be repeated.File descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sWARNING: Running as a non-root user. Functionality may be unavailable.Percentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.There's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Command profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Size may not be relative/signed.Selected cache metadata format %d is not supported.Extents may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Internal error: Failed to parse command definitions.Internal error: Failed to find command id %s../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-cluster=internal --enable-cmirrord --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --disable-silent-rulesUse 'lvm help ' for more informationFailed to strdup command basename.Error during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).Updated config file invalid. Aborting.PARTIAL MODE. Incomplete logical volumes will be processed.--partial and --activationmode are mutually exclusive argumentsInvalid activation mode given.Ignoring unknown search_for_devnames setting, using %s.Failed to copy devices file name.A --devices list cannot be used with --devicesfile.DEGRADED MODE. Incomplete RAID LVs will be processed.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.WARNING: File locking is disabled.Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dIgnore lvmlockd for pvscan cache.WARNING: skipping LV lock in lvmlockd.WARNING: skipping VG lock in lvmlockd.WARNING: skipping global lock in lvmlockd.Run `%s --help' for more information.Failed to read --devices args.Line too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d.Specify options after a command: lvm [command] [options].No such command. Try 'lvm help'.|l\L<, /proc/self/fdFailed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profileGiving preference to command profile specified on command line over the one specified via environment variable.metadata profileLVM_COMMAND_PROFILEC`?`CAACDevices file not enabled.lvmdevices.cDevices file does not exist.No device found for %s.Invalid PVID.Found PVID %s on %s.Device not removed.No devices file entry for %s. PART=%dFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.Not searching for missing devnames, search_for_devnames="none".Updated devices file to version %sNo update for devices file is needed.Updates needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.Filtering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sDevice %s is used by an active LV, continue to remove? PVID not found in devices file.Multiple devices file entries for PVID %s (%s %s), remove by device name.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s%-*s [%15s] %slvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"LVM physical volume%d disk%s%d partition%s%d LVM physical volume%sWARNING: only considering LVM devices%d LVM physical volume whole disk%s--polloperation parameter is mandatoryArgument to --interval cannot be negativelvpoll.cProvide LV nameMovedUnknown polling operation %sPlease enter one or more logical volume paths or use --select for selection.lvremove.clvrename.cExisting logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageExisting historical logical volume "%s" not found in volume group "%s"Renamed "%s%s" to "%s%s" in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differLogical volume %s not found in volume group %s.Ignoring size parameters with --use-policies.Can't reduce pool metadata size.Please specify either size or extents but not both.Negative argument not permitted - use lvreduce.Positive sign not permitted - use lvextend.Please provide the logical volume name.Please specify a logical volume path.Mirrors argument may not be signed.Stripes argument may not be negative.Stripesize may not be negative.lvresize.cACTIVE OriginalSnapshot%s%s '%s%s/%s' [%s] %slvscan.cIgnoring lvscan --cache because lvmetad is no longer used.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.Poll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.ABORTING: Mirror percentage check failed.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.Argument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldpolldaemon.cMissing LV uuid within: %s/%sCan't find LV in %s for %s.afterResolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Failed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to set pvid for devices file.Failed to update devices file.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedpvchange.cChanging uuid of %s to %s. wrappedpvck.cprecommitwxFailed to create file %sid = seqno = description = creation_time = -- Skip writing in test mode.Failed to write new mda textmda_header.magicCHECK: no mem for printing %smda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llulabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %sLABELONELVM2 001pv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %uzero metadata copiesCHECK: second mda not foundNo lvm label found on device.No mda1 offset found.No mda2 offset found.Invalid metadata file.Write new LVM header to %s? Failed to write new headerFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# GeneratedNo mda location.Unknown dump value.Write LVM header to device? Unknown repair value.mda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizeskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.CHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerMetadata text %llu too large for mda_size %llu max %lluCHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationFound bad header or metadata values.Metadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.WARNING: Cannot get device size.WARNING: No LVM label found on %s. It may not be an LVM device.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.Failed to read label_header at %lluWARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %lluFailed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluCHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.Writing label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Found text metadata area: offset=%llu, size=%lluCould not find LVM label on %s--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %spvcreate.cDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"Option -c not allowed with option -mOption -c is not allowed with option -spvdisplay.cFailed to clone VG or LV name.--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.No extents available for allocation.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to move device used for writecache cachevol %s.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Moving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Internal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.pvmove.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.No data to move for %s.Failed to allocate lvid.Failed to clone LV name.Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segmentABORTING: Removal of temporary mirror failedABORTING: Unable to deactivate temporary logical volume %s.ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveABORTING: Failed to write new data locations to disk.ABORTING: Failed to remove temporary logical volume(s).Please remove orphan temporary logical volume(s) when possible.pvmove_poll.cRemoving temporary pvmove LVPlease enter a physical volume pathWARNING: skipping global lock for force.pvremove.cInternal error: Invalid resize params.Please supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedpvresize.cpvscan.c%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*s %s [%s]/run/lvm/pvs_onlineCheck pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/vgs_onlineCreate vg online: %sFailed to create %s: %dFailed to open %sNo info in %sNo device numbers in %svg:No vgname in %spvscan autoactivating VG %s.%s: autoactivation failed./run/lvm/pvs_lookupDid not create %s: %dwrite_lookup_file %s%d:%d vg:%s Create pv online: %s %d:%d %sWARNING: Failed to open %s.ignore lookup file line %sonline_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompleteof exported volume group(s)in no volume groupUnlink vg online: %sRemove pv online devno %d:%dUnlink pv online %sUnlink pvs_lookup: %sLVM_EVENT_ACTIVATION=0/run/lvmCreating run_dir.Creating pvs_online_dir.Creating vgs_online_dir.Creating pvs_lookup_dir.pvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]Internal error: Path %s/%s is too long.pvscan[%d] Path %s/%s is too long.pvscan[%d] %s: autoactivation failed.Cannot create online file path for %s %d:%d.pvscan[%d] Cannot create online file path for %s %d:%d.Incomplete online file for %s %d:%d vg %s.pvscan[%d] Incomplete online file for %s %d:%d vg %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s is duplicate for PVID %s on %d:%d and %d:%d.pvscan[%d] PV %s is duplicate for PVID %s on %d:%d and %d:%d.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.set_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for %d:%dpvscan[%d] VG %s PV %s no device found for %d:%dset_pv_devices_online vg %s pv %s is online %sWrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device found for %d:%d PVID %spvscan[%d] No device found for %d:%d PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sWARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.Ignore PV %s with VG system id %s with our system id %spvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Options -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Ignoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan[%d] Failed to create %s %dpvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.pvscan_cache_args: filter devs nodatapvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.reporter.c in VG sub and its SubLV(s)report_optionsInvalid options string: %s%s: unknown report format.Failed to create log report.No log report stored.Unknonwn report specifier in report option list: %s.Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Merge is in progress, reporting merged LV %s. and also its SubLV(s) with option '-a'WARNING: RaidLV %s needs to be refreshed! See character 'r' at position 9 in the RaidLV's attributes%s.Internal error: _report_all_in_vg: incorrect report typeInternal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.WARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.Failed to compact given columns in report output.Failed to add main report section to report group.Failed to finalize main report section in report group.Internal error: _report_all_in_lv: incorrect report typeInternal error: _report_all_in_pv: incorrect report typeInternal error: report_for_selection: incorrect report typeSupported report formats: %s, %s.Failed to create report group.Failed to add log report to report group.Failed to set log report name for command context.Failed to set selection for log report.use_toollib.cunknown Skipping volume group %sfork failed: %sredirect(lvm2)Allocation of vg_name failed.lock_type %s is invalidSetting lock_type to %sDisabling%s pool zeroing.Setting pool discards to %s.Using default stripesize %s.Unknown VDO setting "%s".successInterrupted.Failed to find device "%s".dev_iter creation failed.Selection failed for VG %s.Selection failed for LV %s.Selection failed for PV %s.Processing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sRunning command for VG %s %sProcessing LV %s in VG %s.positionProcessing each PVdevice_id_list alloc failed.Cannot use %s: %sProcessing PVs in VG %sProcessing PV %s in VG %s.Skipping PV %s in VG %s.Processing device %s.strdup failed.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclChecking %s to confirm %.32s.Check confirm arg %s no info.Cannot read orphans VG %s.alloc pvl failed.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.Using existing orphan PV %s.Failed to find PV %sMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sCannot access clustered VG %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCan't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Forking background process from command: %sWARNING: Failed to set SIGCHLD action.Failed to sync local devices before forking.Background process failed to setsid: %sskip_dev_dir: Couldn't split up device name %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".The clustered option is deprecated, see --shared.Physical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Spawning background pvmove process for %s.Spawning background lvconvert process for %s.Delaying merge for origin volume %s since snapshot volume %s is still active.--ignoremonitoring or --sysinit option not allowed with --monitor option.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".Ignoring deprecated --vdosettings option "%s" and its value.Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.Using unrecognized writecache setting: %s = %s.High watermark must be greater than low watermark.Failed to add tag %s to physical volume %s.No physical volume label read from %s.Option --minor may not be repeated.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Please use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleObtaining the complete list of VGs to processIgnoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.Failed to allocate final LV list item.Internal error: Command %d:%s arg position %d does not permit an LV (%llx)Command on LV %s does not accept LV type unknown (%d).Command on LV %s does not accept LV type %s.Command not permitted on LV %s.Command on LV %s has invalid use of option %s.Command on LV %s requires option %s.Command on LV %s uses options invalid with LV type %s.Command on LV %s with invalid LV type %s.Command on LV %s uses options that require LV types %s.Command on LV %s does not accept LV type %s. Required LV types are %s.Command on LV %s uses options that are invalid with LV properties: %s.Command on LV %s is invalid on LV with properties: %s.Command on LV %s uses options that require LV properties: %s.Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to find logical volume "%s/%s"Processing lockd_sanlock_lv %s/%s.One LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsTags cannot be used with this command.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.Processing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Checking %s for pvremove %.32s.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Checking %s for pvcreate %.32s.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openCheck confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Wiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped.<`n-Wp#3AO]ky \/dev/nullPhysical extent size may not be negative.Failed to allocate filename.vgcfgbackup.cError processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.No backup taken: specify filename with -f to backup with unknown segments.Volume group "%s" successfully backed up.vgcfgrestore.cNo devices found.Restore aborted.Restore failed.Restored volume group %s.Volume group %s has active volume: %s.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.vgchange.c(no profile)Failed to deativate %s.Unable to set system ID.DeaRefreshing volume group "%s"No volume groups changed.VG lock type not changed.No global lock for lock startautonowaitVolume group autoactivation is already %s.Changing configuration profile for VG %s: %s -> %s.vgchange_metadata_copies new %u vg_mda_copies %u D %uNumber of metadata copies for VG %s is already unmanaged.Number of metadata copies for VG %s is already %u.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group allocation policy is already %sVolume group has active logical volumesFailed to generate new random UUID for VG %s.Physical extent size cannot be larger than %s.Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sCannot change to unknown lock type %sVolume group "%s" successfully changedIgnoring invalid string in lock_start listIgnoring empty string in config fileNot starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVolume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.Failed to sync local devices for VG %s.%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredNeed one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinitOnly -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negativePhysical extent size may not be negativeChange clustered property of all volumes groups? [y/n]: Lock type can only be forced to "none" for recovery.Forcibly change VG lock type to none? [y/n]: Using lock type requires lvmlockd.Using lock start and lock stop requires lvmlockd.Starting locking. Waiting for sanlock may take 20 sec to 3 min...Starting locking. Waiting until locks are ready...Starting locking. VG can only be read until locks are ready.vgck.cFailed to write VG.Failed to commit VG.The volume group is missing %d physical volumes. with system ID vgcreate.cFailed to get tagFailed to start lockingPlease provide volume group name and physical volumesA volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.--- Physical volumes ---vgdisplay.cOption -A is not allowed with volume group namesVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedPlease supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.vgexport.cVolume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedWARNING: PV %s not found in VG %sWARNING: The PV %s is still missing.WARNING: PV %s was not missing in VG %sPlease enter volume group name and physical volume(s)Volume group %s not changedvgextend.cNo PV has been restored.Volume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedPlease supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.vgimport.cvgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.Failed to write devices file.Devices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Internal error: Old vg name %s is too long.Temporary vg name %s1 is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Not importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file.vgimportdevices.cNo devices to add.Checking for volume group "%s"vgmerge not allowed for lock_type %sPlease enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Failed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"vgmerge.cChanged LVID for %s to %svgmknodes.cWARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.vgreduce.cWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Please enter one or more volume group paths or use --select for selection.vgremove.cVolume group "%s" not removedCan't get lock for %svgrename.cRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedNew VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sRenaming path is too long %s/%s %s/%sVolume group "%s" successfully renamed to "%s"Old and new volume group names need specifyingexported vgscan.cFound %svolume group "%s" using metadata type %sCannot notify dbus: lvm is not built with dbus support.Cannot notify dbus: notify_dbus is disabled in lvm config.Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedCan't split Logical Volume %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groupsVolume group "%s" became inconsistent: please fix manually%s volume group "%s" successfully split from "%s"vgsplit.cExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not foundHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandToo many arguments. Limit is %d.config-util.cFailed to duplicate node key.%t%.*s= %ld %.*s= "%s" %b%.*s%sInternal error: Bad format string '%s'Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit form end %dInternal error: Message response doesn't contain terminating NUL characterFailed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) faileddm_task_set_message: strdup faileddm_task_set_geometry: sprintf failedTarget type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedInternal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.WARNING: Setting UUID unsupported by kernel. Aborting operation.WARNING: IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronisation interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataAttempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)Failed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.Hold of control device is now %sset.libdevmapper exiting with %d device(s) still suspended.Ϗ@ @@k@@8@ΟΟΟ@@w [trust_udev] [verify_udev]device_mapper/libdm-common.c%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sDM_DEBUG_WITH_LINE_NUMBERS%s:%d #+-.:=@_selabel_open failed: %sFailed to build sysfs_path.%s/block/bdiqueueuremovableslavetraceuevent%sblock/%s/%s/devsemid %d: semctl failed: %sUnstackingStackingDM_DEFAULT_NAME_MANGLING_MODE1.02.181-RHEL8 (2021-10-20)\x5cx\x%02xName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s%2x%sName "%s" too longSELinux context resetsetfscreateconlsetfilecon%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %uNew uuid prefix %s too long.%*u %*u %u:%u %4096s %4096s%sdev/block/%u:%u/dm/name%sdev/block/%u:%u%sdev/block/%u:%u/holders%sfs%sfs/%s/%sFailed to get driver versionDM udev checking enabledDM udev checking disabled%s: mknod for %s failed: %schownCreated %sRemoved %sRenamed %s to %sProcessingFailed to build size in kB.BLKRASETSkipping SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRY%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%sselabel_lookup failed for %s: %sCouldn't create path for %s/%s.semid %d: sem_ctl GETVAL failed for cookie 0x%x: %ssemid %d: semop failed for cookie 0x%x: incorrect semaphore statesemid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdUdev cookie 0x%x (semid %d) incremented to %dKernel not configured for semaphores (System V IPC). Not using udev synchronisation code.Udev is not running. Not using udev synchronisation code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notificaton semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %sInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Failed to build dev path for "%s".Insufficient memory to stack mknod operationSuspended device counter increased to %dAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %ddm_task_create: malloc(%zu) failedThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.Internal error: mangle_string: supplied buffer too smallThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %s_task_get_string_mangled: strdup failedInternal error: unmangle_string: supplied buffer too smallThe %s "%s" should be mangled but it contains blacklisted characters.Hex encoding mismatch detected in %s "%s" while trying to unmangle it._task_get_string_unmangled: strdup failedFailed to unmangle device name "%s".Failed to mangle device uuid "%s".Failed to unmangle device uuid "%s".Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedDevice uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedPreparing SELinux context for %s to %s.Resetting SELinux context to default value.Setting SELinux context for %s to %s.%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGETFailed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u)._sysfs_get_dm_name: failed to allocate temporary buffers_sysfs_get_dm_name: dm_snprintf failed_sysfs_get_dm_name: supplied buffer too small_sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallDevice %s (%u:%u) appears to be mounted on %s.WARNING: sysfs_path dm_snprintf failed.Failed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sA non-block device file at '%s' is already presentUnable to unlink device node for '%s'%s not set up by udev: Falling back to direct node creation.Node %s was not removed by udev. Falling back to direct node removal.The node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uCould not set notification semaphore identified by cookie value %u (0x%x)Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Could not signal waiting process using notification semaphore identified by cookie value %u (0x%x)x(8HXhx/proc/self/mountinfoWARNING: Ignoring unsupported value for %s.%s not found in config: defaulting to "%s"%s not found in config: defaulting to %ld%s not found in config: defaulting to %fvsnprintf failed for config linedm_vasprintf failed for config linedm_pool_grow_object failed for config line_write_value: Unknown value type: %dFailed to clone config string value.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): expected a string token.WARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueParse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sdm_pool_begin_object failed for config line%s not found in config: defaulting to %dFailed to allocate config pool.Failed to allocate config tree.Cannot clone NULL config node.Failed to clone config node key.Failed to create config node's key.device_mapper/libdm-config.c%f0%lotruefalseFailed to clone config value.Failed to duplicate token.Failed to allocate type valueFailed to read int token.Failed to read float token.Failed to allocate value%s}[%s,%sconfig_outputFailed to clone config node.Failed to create config node.ppppppp@pppp(ppppppppppppppppppppppppppppppPppppppppppppppppppppppppppppp`p X 0 _create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion failed_info_by_dev: Failed to set device number.Deactivation dm_task creation failed for %sFailed to set device number for %s deactivationFailed to set message major minor.Failed to process message "%s".WARNING: Can't set no_flush flag.Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Failed to set device number for %s resumption.WARNING: Failed to set read ahead.Device id %u is higher then %u.Expected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.dtree node segment allocation failedFailed to allocate target segment area._deps: failed to set major:minor for (%u:%u)._deps: failed to set inactive table for (%u:%u)_deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uNode %s must have only one segment.Expected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).Failed to format %s device number for %s as dm target (%u,%u)WARNING: Ignoring RAID1 stripe sizeFailed to get %s target versionsReload dm_task creation failed for %s.Failed to set device number for %s reload.Failed to set read only flag for %s.Insufficient space for target parameters.Can create VDO data volume path for %s.Correcting VDO virtual volume size from %lu to %lu.V4 %s %lu %u %lu %u deduplication %s compression %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %u%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sTarget parameter size too big. Aborting.WARNING: Failed to suppress reload of identical tables.Suppressed %s identical table reload.Table size changed from %lu to %lu for %s.%sResume of table of extended device %s delayed.Insufficient space in params[%zu] for target parameters.dtree uuid hash creation failedResetting %s udev_flags from 0x%x to 0x%x.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Matched uuid %s (missing suffix -%s) in deptree.Matched uuid %s (missing prefix) in deptree.Not matched uuid %s in deptree.Couldn't find snapshot origin uuid %s.Couldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %sFailed to set device number for %s table clear_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Sent messages to thin-pool %s and skipping suspend of its children.Suspend dm_task creation failed for %sFailed to set device number for %s suspension.WARNING: Failed to set skip_lockfs flag.WARNING: Failed to set no_flush flag.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).Rename dm_task creation failed for %sFailed to set name for %s rename.Failed to rename %s (%u:%u) to %sCreate dm_task creation failed for %sFailed to set device name for %sFailed to set device number for %s creation.Failed to set read only flag for %sInternal error: Unable to get DM task info for %s.WARNING: Failed to get uuid for dtree node %s.Couldn't find mirror log uuid %s.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Missing integrity's meta uuid %s.Missing integrity's origin uuid %s.Replicator segment is unsupported.Replicator targer is unsupported.Failed to allocate thin message.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Missing thin external origin uuid %s.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.dm_tree_node_add_null_area() called on an unsupported segment typedevice_mapper/libdm-deptree.cname pool_strdup failedRemoving %s (%u:%u)Failed to set major minor.Resuming %s (%u:%u).no targetdtree link allocation failedNode %s is missing a segment.Node %s has segment type %s.compression oncompression offindex-enableindex-disableParsing VDO status: %s%s%s %lu%s %d %u nosync rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing (Ignoring.)Loading table for %s.clustered-userspace %u %s clustered-%s%s %u 1 handle_errors%s %s %c %d%u %u /dev/dm-%uV2 %s %lu %u %lu %u %s %s %s %s%s%s%s%s %s %lu %s %s %d %lu %d%s%s%s%s%s%s %d%s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u meta_device:%s recalculate journal_sectors:%u ineterleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%lludtree hash creation failedFailed to allocate dtree. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapMatched uuid %s in deptree.Dropping callback for %s.Reverting %s.Unable to deactivate %s. with device flush with filesystem syncSuspending %s (%u:%u)%s%sUnable to suspend %s (%u:%u)is used by another deviceconstains a filesystem in useDevice %s (%u:%u) %s.Renaming %s (%u:%u) to %sUnable to resume %s.Creating %sFailed to set uuid for %slog uuid pool_strdup failedUnsupported raid type %s.Missing cache's data uuid %s.No integrity meta uuid.Missing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Unsupported message type %d.Missing thin pool uuid %s.Couldn't find area uuid %s.Missing VDO's data uuid %s.>D<B>A='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]device_mapper/libdm-report.ctype-specificfield-specific": [string listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%sSelection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %sUnsupported selection type%-*.*s\Missing end quote.%s: field name too long.Unrecognised field: %.*sExpecting field nameMissing value after operatorSpecified month out of range.Specified day out of range.Specified hours out of range.report selectionExpecting logical operatordm_report_init: malloc failedreport_groupShow help.Specialspecial_&&All fields must match||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end=~!~!=>=<=sinceuntil %Incorrect time format.Incorrect date format.Failed to parse string list value for selection field %s._display_selection_help: dm_pool_grow_object failedSyntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'?= # and <#devices> and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to parse writecache params: %s.Failed to parse integrity params: %s.Failed to parse invalid thin params.Failed to parse thin pool params: %s.Failed to allocate thin_pool status structure.Failed to allocate thin status structure.Failed to parse thin params: %s.Failed to alloc mem pool to parse mirror status.Internal error: More then 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.device_mapper/libdm-targets.c%lu/%lu %luInvalidMerge failedOverflow<#devs> %s %u %s %lu/%luErrorFailwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s%d ro needs_check%llu %llu %llu %llu%llu %llu %s%lu %lu/%lu %lu/%lu%nout_of_data_spacero Allocation of devs failed.%u:%u %nuserspaceAllocation of logs failed.get_timestampclock_gettimedevice_mapper/libdm-timestamp.cOut of memory. Requested %zu bytes.Couldn't create memory pool %s (size %zu)Internal error: pool_free asked to free pointer not in poolYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Pool %s is already locked.Internal error: Pool %s is already unlocked.Internal error: Pool %s crc mismatch.device_mapper/mm/pool-fast.cdevice_mapper/mm/pool.c [%p] %sPool %s is locked.Pool %s is unlocked.device_mapper/regex/matcher.c(.*(%s)%c)Couldn't parse regexregex fingerprint(rx->type != OR) || (rx->left && rx->right)Internal error: Unknown calc node types0sPrHt0s_fill_tableIncomplete rangespecificationBadly formed 'or' expressionParse error in regexRegex optimisation errordevice_mapper/regex/parse_rx.cBadly quoted character at end of expressionmissing ')' in regular expressionRegex charset allocation failed|~~~0}0}0}0}~~P}~~~~~~~~~~~~~~~~0}~~~~~~~~~~~~~~~~~~~~~~~~~~~}~~|~~~~~~~~~~~~~~~~~~~~~~~~~~~~~0}܄܄l܄device_mapper/regex/ttree.ccouldn't get token for '%s'couldn't parse '%s'out of memorycouldn't get token for deviceoperating modeindex statecompression stateused blockstotal blockstoo many tokensrecoveringread-onlynormalerrorclosedopeningclosingofflineonlineunknownonlineofflinefstatdevice_mapper/vdo/vdo_reader.cFailed to open VDO backend %s.Found mismatching VDO magic header in %s.Expected geometry VDO block instead of block %u.Unsupported VDO version %u.%u.File/Device is shorter and can't provide requested VDO volume region at %lu > %lu.Unknown VDO component version %u.VDO metadata has mismatching VDO nonces %lu != %lu.dmvdo001VDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is larger than limit %lu TiB by %lu KiB.Failed to allocate memory for hash.Failed to allocate slots for hash.base/data-struct/hash.cbase/data-struct/list.chead->nhead1->ndm_list_splicedm_list_add_hdm_list_add``@ hP`ȠP`@S= Щ8pXP@hx`` p`X_dump_degrade_to_n48_degrade_to_n16_degrade_to_n4unused value is not UNSET (n4) unused value is not UNSET (n16) referencing value past nr_entries (n48) not all values are referenced (n48) incorrect number of entries in n48, n48->nr_entries = %u, actual = %u unused value is not UNSET (n48) incorrect number of entries in n256, n256->nr_entries = %u, actual = %u ./base/data-struct/radix-tree-adaptive.cincorrect entry count: rt->nr_entries = %u, actual = %u duplicate entry (n48) %u value in UNSET (n48) unknown value type: %u shouldn't get here n4 != NULLn16 != NULLn48 != NULL values[i].type != UNSETt?Hu0AuPAu Bu CvpDPvEvFvGvJDwKwpMwPNx0OLxPxPxQxPR8yS|y0TyTyTyW,zYhzYzZz \T{i0|m|r}@|x}|}P}}}~~4~`~~~4`hІp08T `8`@ԁЌ ph `4Xx̃P0`PT`pȅ \`|PP < P0dPxȇP`̈ \$0D@P`̌40HP\ XЏ p <X Pp0D|L`0D X0l@P`pГ(<@ԔP@0@0Xl `8ؘ  8\0  04pL`P4lP #L`#,\-6:0B 0DLpEP\]<0_@_d,f gpggH0ht`immmmPn4nX`oxopqq8`rdrpst@uDu|xz8`zX| p(PP `Pp@0@Ћ`p( Xpt8XlP 0 P pl  p 4 P 0L   P `@ \ p  Ь   0 p4 H ` `  @lp@x0(@\00D X0|4ppPp4P,`x @PHt `, h|P4 ,   Pp@l& P(l++P,,<.t222 2 3( 4d 5 06 9P!:d! :x!@:!F#`I$I$K%M%P%Q&Q &`T&X '0X<'0Y'pY' Z'p[((\(@a@)b)Pi *jX*pk*r* |+,p ---4.H.@\.Pp.....@0`0`1p11` 2p 242p2202@3Ц(3P33@3@4 l5@55P5 6<60h6й667@\7px7p78(8 `8P|88@8`89`$9` :t::;0;P,;x;;<Ph<p<<p===>`D>p> >>P ?L?p? \@@p@@0$AAAA`BBBB0 C@`CtC CDD` `D Dp D D D E $E 8Ep pE EEEEF(FDF\F0pF@FPFFFFF@G`$G8GH,H@HTHpH!H@"H%I`)$JP*`J`+J+J+J+J+J+J,J0,K,(OCO0IOIP`N`P`QP@Z QP]|Q^QaRc\RcRdReReS`f(SqSrS`u(Tu`P>pAAAA$A8BL0B`PBtpBBBBBC0CPCpC(C<CPCdCxD0DDEDIpJJJ(J<Kh@LPN0^Pddkqrr sxy y@ z`{P{{p0px XTВ@ 8ГL  (`<pPФ0 D X0lP0`xPp0DXx`(Pdd 8d`4LP  P`0(<`\P@P@D P4HP\p#($l&`.P./112,p2L2`2t2 3P3p333333(4<4P 4d04x@4P444@585l0666607,7H7\9p?@<AAPBBCG HPHHH H(M@PXQ0SSPUHUtVP[( [\ \  ] ] `t f g Pj 0l l8 m\ Po 0rPs0t@tu0w{TP|`|$@Th 0@P`p(<ЀPdx 0@(< P0dPx`Ѓ,@T h0|@P`p0DXl 0@P`p  4H`t0@4@LP`<`lPЏА@Pxp0PPp@LxЗ@ 8L`Йx`@(0t@@lp `8 ЭP h    !!а(!@!PX!P!"$"г8"L"0`"ж""#``##$$\$`|$`$%,%Px%p%%%%%%0&P&p,&@&T&h&|&&0&P&p&&&''0'0D'PX'pl''''''0'P'(0(L(h(@(p(((()0,)`H)d)))) )@)`*$*@*\*x** *@*`*+ +<+X+t+0+P+p++,,8, T,@p,`,,,,, -@4-pP-l-- -P--.`<.X.t... .P.//8/T/0p/`//// /P040P0l00@00@0 1 <1@X1`t11 1@1p12,2H2 d2P2222203P3p,3@3\3x33303P3p3344,4@4T4 h40|4@4P4`44 5p(5D5@`5|5`555 505@ 6`P6pd6x666`7H7 t777@7`X88 809l9p99(: D:::p:;@@;l;;; (<d<<`<< =0= H=P|== =(>T>h>>>0>@>>p8?l?0? ? (@ D@@ @ @,ApHAAAAA B BP 4B HB \B pB!B@!B!B!B"B@"$C"LC"tC#C@#C#C@$Dp$4D$`Dp%D%Dp&D&E@'0E'dE'xE (E(E(E0)Ep)E)E0*F*@F+lF+FP,F,F0-,G-dG.G.G. H`/DH/|H0H00H0H1I1LI2tI4I@5Ip68J6`J`7J7J@8K88K 9lKP9K :Kp:K:K;L`;L;0LM?@M@M@M@MpAMAN`B4NB`NCN@DNDNPEOE0O@FPOFpOFOFOpGOGOPH PH8P@IXPIPJP KPKQK8QMQNQNQ OQORPPhR QRQRR$SR\S SSSSPTT UTTUTUT@VTVUpWdUWUPXUXHV0YVYVZ,WZXW`_W`Wa Xa4XaHXpbdXbX`cXcXpdXd0Y@e|YeYfZ`f`ZfZgZ`h[h0[jt[`j[j[m[@m\ nD\0nX\o\0o\`o\o]p@]pT]`t]t^t$^v`^w^ x^x^y^y_@y$_Pzh_p{_|_ } ``~P`~``0`Papa,aDa`aatbbb@bPbcPTcc0cpPx@x@By`E|y`HyKtzNzpQ\{T{V|_|``|`,}`aP}ap}c}c}c} d~fp~f~nXn@rux0vvv̀wPxxxxԁxpz ~8~L`p ,@ ԅlPl `lЙ`К8 dМpX0$@8PL``0@܌<p`L0TP@X`( ܓ@x0@@hؗ@\Ęؘ0`0DX l ̙\@̚`|p H$@p l@О0dx@@\!#@%H@&'(D@*p*Ȣ-.(ẸFG@P@RUVWt@XPe`epe(e@Pfg̦gggg$ k\pl`o8o\ةHБ|@p Pp(d0`@@Ԯ$`@ 0H@T @8Pplĵ@0ȶL  ĹhȺ(0"Ȼ0(( 0>T?t?̽@JL@W\l]`c0jprD s|sz{P0~dЍ\|(БHhPPlP0Px0 @0 (pt@(ЩH @ @@ @@tp<P  L@T@(p0P p 4L   !#T#h0$@%+,,,`-L-.000\ 1`112,3X 3l3066P77<8T`8t889`99 : :X ;tp;<`<p<<=( =<`=d=x >P>>`?@LA AAB BpBBC$D80ELE`H@HpHHI J$K`{{4|P0 DPH X@Xpи$pнpx@  `TP|0Px@p00)TYx[0]X]^_`sPu`zh@{{~(hЃ(0`|$h  @h @|   t    0 @ P `@ xP,(t@04PHp\p  408x@ `\0P(< P 0<Pp!@$8 (p+ @/l//06p9;@4@lAG0L`PMN pOLPSPWhZe m` o t$!0w!x!0y"PzH"{"|"}#}H#@~#PL$$$$%@&`'`8)0)),*p+0+0@, ,,4-PX-p-..,.d.P..$/PD/d//0"`00&0@' 1-1@12 7l292@< 33>(4I40J4 L(5N5O5QX60S6UP7pW7X7pn8Pp8s@9tl9 9$:`h::;;<P<<P<|==>>?pl?@4@H@ \@0p@@@@@ @0AAPAAPB؂@EPE`L@pSTUDU`U|0VVV܅@WWHY Z[\]h0ḃ@d0fdpf|fiildm`mm؉o<0prs$s8uv̋y4z@{Ќ`@ Ȏ܎`|@@Џp0XЊp0|Г`<XГ 0t08дЕ@ xп`<pd@  4 \0̚P8Xl@ě`؛@|М 0 p  P`pĞ؞  0"#`#0$$%0&T&p0((ء0))+P,@--Т..1Tp7ȣ7P940>BCtDFGLH0OOPPTPhP|PP`Qا RR<@SlPSS T̨TU(U<UP@V|VVЩW(W<X\ ZpZܪZ`[<[d\]Ы^ _\ijl00mDnx@oĭ tpv`w{<`||} ~ ~Pdx@İ@80@P L`ܴВXt ȵPД<0tp  X t0@ȷЗܷ `@TИh| @и`08h|`ܹ`tغT0л p@l@`pĽн04XzRx $FJ w?:*3$"Dt\P#BHE E(D0A8G]HAB`Z 8A0A(B BBBD HIENHfBEE E(D0D8D@o 8D0A(B BBBG H ,-BBB B(A0A8G 8A0A(B BBBH xlBBE E(A0D8GPsXH`eXAPXH`bXAPF 8A0A(B BBBH i 8F0A(B BBBH 0IAKG N LEN DCALBBE D(A0m (A BBBF M(D BBBLl0BEB D(G0a (A BBBD N(A BBB4AKG N LEN H CAD xhAN ` AH 4ĹBDA L ABJ NABHPLFBB H(A0[ (C BBBI F(C BBB`FEE A(D0 (D BBBK Y (A EBBE  (D BBBA 0,mEKG N LEJ eFA4hHt\ 0p9EDG M CAG DGA0ZEDG M CAG eGAX4FJN Q(A0I8D@HMPZXE`K@L 8C0A(B BBBH 4 @HFBA A(G L"  (A ABBD ` FEE E(D0D8DPq 8C0A(B BBBB W 8J0D(B BBBK FH0x A T aFEE E(D0D8G@MHKPKXB`I@D8A0A(B BBB<dBID DPu  AABD gXI`^XAP(h EJIP AAE DLSFED D(G0M8K@KHBPI0D(A ABBd.FEE E(D0D8DPHXJ`KhBpIPv 8D0A(B BBBD iXH`JhBpIPnXL`MhBpIPNXJ`JhBpIP_XK`MhBpIPMXJ`HhBpIPhXM`LhBpIPwXK`JhBpIPhX_`BhBpMP|XH`KhBpQPXM`HhBpIPVXJ`JhBpIP@FMH A(F0G`T 0A(A BBBK 8`FAD N ABD k ABB LFKH A(G0V (C ABBA o (C ABBI HXFBE E(D0K8G@m 8C0A(B BBBG 8 0L FID D0k  AABJ < <FJH G0|  AABA H8g@H8A00 HFJH D0F  AABJ <  FJE G0E  AABK H8g@H8A004 FJH D0F  AABJ 0h CFJH D0F  AABJ H FBD A(G@ (A ABBJ HNP\HA@X FKH A(G0L (C ABBK j (C ABBF g(C ABB0D 8FDA G0  AABD 8x FJD D(D@n (A ABBH 8 8FJD D(D@n (A ABBH 0 FID D0b  AABC 8$ FBD C(G@| (A ABBH (` ,EFD0I AAF L FJL F(G0T (C ABBK F (C ABBB @ FEA A(D0h8G@h8A0D(C ABBL FBE A(A0D`hGphhA`V 0A(A BBBA p \H X H  , FAD  ABB 8 )FAA { ABJ T ABI , sEAG I U AAA \<`FBA A(D0} (C ABBE w (C ABBI e (C ABBC X@FBB A(A08J@Y8F0A (A BBBH ~ (C BBBA  FFB E(D0C8N QL VRTAe 8A0A(B BBBD GHcBH[BFKBHdAkPKA HS ^ KL pBBE H(A0D8GcGBM 8A0A(B BBBF J\B`HTBBE E(D0A8G]GBAI. 8A0A(B BBBF l FFB B(D0D8Ju 8A0A(B BBBG rH_BM\A(EHG`e AAA (H$rEHG`V AAA 4tx{FDD X ABG GAB(EHG`q AAI (TEHG` AAA <(gEAD Z CAH S CAI RCA4DXFAA _ CBD XFBX|]FBB E(G0D8Dpt 8A0A(B BBBD xN]xDp0YEDG q DAJ DCA MHM K h, HI D(EG0_ AD 4h[HD } AAJ @AAF8,EGG q(M0_CAD ZDOEQ4EGD0_ AAG _8M@Y8A000 [aGG T FAF HAA$d >EKG QJG$ AEKG QJJ$ CEAJ nCA$ FEAJ qCA$H FEAJ qCA,p :AU J Y(L GBDA uDBx :At *E`X dBBA A(D08O@W8A0D (F CBBE K (C ABBE 4  JBAH q ABA FABD ]DXd BFA D(D` (A ABBK hQp[hA` D@ D D@ I $A` G ~ J H G F 0 (D>FHC iABp, (6T@H[ E UHtFBA H(D0p (C ABBC D(F ABB0EKD  DAJ DAA8t@4L\FEA h ABA \AB \FBB B(D0A8M@p 8A0A(B BBBA D8N0H(G IBB\4FBB B(D0A8M@p 8A0A(B BBBA D8N0H(G IBBXlBBE B(I0D8JL^Aa 8A0A(B BBBD DNkBMSKMEPH2Ee F A Ko F s E DXPHh H W<dFHA DP  AABH VXM`\XAPHcEb I rLEF  4FHA k FBF QCBT8HU8l@FGA ] ABB F CBE xFEB B(D0A8D@[ 8F0A(B BBBF h 8C0A(B BBBD  8F0A(B BBBI $4En@kTHYEOpFBB B(A0A8D7MMKI 8A0A(B BBBF IMNPBHQDI FEB B(A0A8G 8A0A(B BBBG HTDN`SE@M]BLI\DMKaADM]EIELFKK^MFADY\hIAHFIXUAHKYUAHKYUAHKYUAHKYUAAK$`FBNKhBwMeUK_BRI^DWMkB]M^A|J_A_K^AK^DnK_BH]AK_BSKmBXK^AKmBXK^BsKmARIBMgBR MW ;5H] K DH;BBE E(D0A8Dp 8A0A(B BBBH 4 = H =\ =&p =(FEF B(A0D8G` 8D0A(B BBBI h\pLxGBBI`hWpHxLGAS`hUpExGBB[`h\pRhB`WhNp\hA`ZhNp\hA` hUpExGBBI PhKpLhF`@T!EHFFB H(A0G 0A(A BBBK <!FFNO M(A0 (A BBBE !G!G"GFFB B(A0D8G~VMGTS[AQMaIU HbAaMQ }M`Bk 8A0A(B BBBA H"KFBE A(D0L (C ABBJ D(F CBBt"0L*FBA A(G08M@\8C0D (A ABBG  (A ABBH t (C ABBD X 8P@P $t#MXYQM \CA$# NIEEG nDA#HN!EW#\N!EW#pNBFBE B(A0I8JMIaFrLUEy 8A0A(B BBBE ~^PARFJA$0T,HJJ O$@T$LT$XT4$dTEDH E CAF U CAG 4 %TEDH N CAE u CAG HX%UFBB E(A0Q (C BBBF F(C BBBH%UFBB E(A0Q (C BBBF F(C BBB%,V H&(VFBB E(A0R (C BBBE F(C BBBHP&\VFBB E(A0R (C BBBE F(C BBB&V6Ea J E&V&HZ&V &V &V 'V $'V8'VL'V`'Vt'V'V ,'VQHD ABJ'PWVD'WFIB B(A0A8D@u8A0A(B BBB((W1EkD(XJRXVId(HX!x(dX (`XH@ H 8(XyODG DAAHH FAAH(8YFED A(M0V (A ABBG D(N HGI00)YxEGD w AAG DRM0d)YEJG } AAK DRM$)DZvE| G F B e)Z$)X[\Hq G D L K)[*[$*[ l8*[FBA A(D08N@\8A0Q (C ABBF z (C ABBF  (C ABBA *]PFBB D(K0G`0hNp\hB`Z 0A(A BBBB W hQpH U hQpJ ShAp[hA`X hQpO } hQpJ c hApJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ UhMp^hA`U hPpG +eEG0E AF +eRE[ H iD+ fVFKD _ ABI f ABG h ABE $,8k!HX<<,PkEND t CAA e CAG jCA|,l,k,k ,kmFFI K(D0D`hMp\hA`Z 0A(A BBBD V hPpJ T hPpL RhAp\hB`c hPpL T hPpL T hPpL T hPpL P hPpJ \ hPpJ P hPpJ @ hPpJ T hPpJ T hPpJ T hPpJ T hPpJ ` hDpE ` hDpE F hApJ ] hGpE -`sRE[ H i -sEG0A AB 8.LtFFAA  ABD i ABD D<.`u&FKD  ABI f ABG L ABA <.HzEND t CAA e CAG jCA.z.z6Hm.{ /{BBA D(N08M@_8A0D (D ABBI a (G DBBH T8M@\8A0G (A ABBE T 8P@L T 8P@T T 8P@L T 8P@L D8P@,/}BDA  ABE 4/EDD  LKN p AAF 0|RE[ H i00BBB B(A0D8G[ 8A0A(B BBBG J`BGFIBMUAJLNHcLcBTOAd ME 00̅9EDG M GAK DCA$1؅X FBB B(A0A8G} 8A0A(B BBBD H_TA]bLAHT\BADAAADDeGKIFN PQ HVCNX2\!AAG h AAE W(I0d(A f(H0^(A D AAH [(H0_(B \20FBB D(K0G@HTPHHC@^HNP\HA@Z 0A(A BBBD bHFPWHB@T HQPJ P HPPP @ HPPP b HFPH v HQPQ } HQPJ j HQPJ U HQPJ { HQPJ U HQPJ } HHPE b HEPE b HDPE f HEPE [ HLPE aHDP8X3DyFBA A(D` (A ABBF \3FKD  ABD f ABG M(M0^(C A ABI d ABI 3؛FBB D(K0v8N@\8A0C (A BBBD b8F@V8D0A (A BBBF d8Q@M8A0Z 8Q@J P 8P@P P 8P@P b 8F@H 4P4FNA  ALE i ABD d ABA dAB(48>BDA sABL 5LBGA D(K0 (M HGIO d (A ABBF Xp5}BGB A(A0 (D BBBA t (A EBBB D8K@[8A057Aa N F45AHG y CAC p CAD $$6CAAG wAA0L6rBLD D  AABG (6\>BDA sABD6p\BDA G  AABF RMTTK06ADG K CAE mCA8(7BBD A(D0x (D ABBB pd7x1BBA A(G0b (C ABBI D (F CBBG j (C ABBF l (C ABBD P7DBAA  ABK P ABE d ABA d ABI P,8BIB A(A0Gpd 0A(A BBBF LxCexApH8\BGB E(A0A8G@X 8C0A(B BBBC P8fBHD  ABF i ABD d ABA [ ABB 9ܳAn A v J HD9XBIA A(D0X (C ABBG D(F CBB(9EAD y DAH X9BEB B(A0A8Dpm 8A0A(B BBBA ZxH`xAp|:TFIB B(A0A8G@ 8F0A(B BBBB I 8C0A(B BBBK  8A0A(B BBBF :BBA A(G L@LA}AMAYABA' (A ABBI !AMAMAQBNAZAOA[AFA1AMAMAQBNAcAUAFAFBFBFBFBFBFBFBFBFBFBFBWAQAIA^AAA4x;AHG M DAN o CAE 0;xuFMN B(A0I8D@ 8C0A(B BBBG ,P>BFAA  CBF p> FEB E(D0F8KPXF`HhBpWP 8D0A(B BBBE # XM`ThBpE > ? ? 0? D? X? xl?\MIE E(D0D8JP[XG`OXAPP 8D0A(B BBBG `PPHXL`vXAP8?EO_ R HAJ D(M0cCA8$@HEO_ R HAJ D(M0cCA8`@EO_ R HAJ D(M0cCAT@BEB B(A0A8D@W 8C0A(B BBBD ZHOPMHA@\@xBBB E(D0A8D 8A0A(B BBBE |QjAXTABBB D(D0G@ 0A(A BBBB F 0A(A BBBB HAP2NE^ E 48P2EAD r AAB e CAG 4pP\3EAD r AAB e CAG 4P3fFED A(D0K(A ABB$P3:EDD jAA4Q4OFAA q FBG ACB@@Q,4xFAA e ABH G DBK bCBLQh4FBB A(A0[ (C BBBH F (C BBBI HQ4FEE G(A0b (C BBBE F(C BBBH R,5mFBA A(D0H (A ABBD F(A ABB4lRP5WFDD ] FBE YCBHRx5!FBB B(D0G8F` 8A0A(B BBBA HR\6FHE E(A0A8D`% 8A0A(B BBBC BHD lAB$T8gFBB B(A0A8Dp; 8A0A(B BBBI x\RxApwxS[xCpFxOODNpPx^DAADNpKxMRDNpT:*A\ C EDT:EDG t FAE D(C0i(F D AAD D(F0<4UH;EAG m FAG T(C0h(A IAA0tU;EAG j DAL |DAU<FEB E(D0C8G`hMpVhA`N 8C0A(B BBBD v 8A0A(B BBBH c 8F0A(B BBBF A hMpJ c 8C0A(B BBBI nhOpYhA`bhKpihD`vhOpfhD`FhOpOxAN`Ph^pDxAAAN`UhMpRxAQ`HV?FOB J(D0A8G 8A0A(B BBBG 4V`@PFEA b HBH HABX4Wx@REB D(A0u8D@T8A0E (A BBBH I(A BBBHW@BBD E(D0c (C ABBD D(C CBBWA+TV(WAAAG@v AAA ` X|A)BBE E(D0H8Dp 8A0A(B BBBD txN[xApf xNJ \XHCFBA A(D0 (D ABBG w (D ABBH r(D ABBXDPEJHYDFBB E(D0G8D`} 8A0A(B BBBA LYG`Y|G tYxG0YtGFDC G@P  AABH TYGFEE B(D0A8Dp\xLfxCpX 8A0A(B BBBB ZJEe F B ^ 48ZDKFFH G(D0a(A ABBpZKE^ ] <Z\L.FAF D@  AABH LHCPgHA@8ZLMFBA D(D` (A ABBD 0 [M~FDA D@e  AABA @[,N"T[HN08h[dNFEA C(D0 (A ABBA [O[$OYEc H x[hOOBEE B(D0A8G` 8J0D(D BBBG D 8C0A(B BBBH D 8F0A(B BBBE @P\Ek H Ahy=dN yuLb B zFyX^FEE B(D0A8Ik 8A0A(B BBBK XzHAHFFO`MZBHN[Af8t>^4L>FPF z ABG OAEH?h?`@8l@FAA { ABJ X(a0O(A ,AFDA m ABE ,A<HW \HA<HW \dA<HW \tA6FBB B(A0A8DMOJEHCDBBIT 8A0A(B BBBH DBvFAD V(K0K(A P(]0L(A s HRQ l@CFBB B(A0A8DMjLxH^Ab 8A0A(B BBBD <lGFAA DpxkHxHpp  AABE `H3FIG GPtXG`BhOpFxBBBHCCAKPT  AABI $TIFBB B(A0G8JFTAI_ERHKXoL`B 8A0A(B BBBD oDnD2JZAeNeIB{_MA FV qLZAOFHKiFTE`|p_hHDD F (M0`(F ](F0D ](M0`(B c(F0T(A A ABB ADRT|`cFPK B(A0I8K@THIPKHD@8F0A(B BBB8aLaFBA A(GgTQFKxFMEHiDTHbAy (A ABBE БfFBB B(A0H8GELGGBBGGIAGEAIT 8A0A(B BBBF 8XgFAA V(I0V8F@K AAB((hNFAE ~AB(LhVFAH CAB(hVFAH CABh'L,i;FBE B(A0A8G 8A0A(B BBBH |mm mmRE[ H i ؓnyE] F m K pnEZ A nEP\8nUFPD J(D0A8N@ 8F0A(B BBBA h8C0A(B BBBo,oEND _ DAE (ܔp~EDD } DAI 8pjFBB A(A0V(A BBBDD(qFEE H(D0A8G@_8D0A(B BBB,qQFAA  ABJ (rnEAG l DAJ 4rMFAA n ABG EAB| sFBE B(A0D8G@s 8D0A(B BBBE HH@PHHB@Z 8A0A(B BBBJ eHRPTHA@8|uFIA  ABC a ABD ܖvMEQ J h`wFBB B(A0A8D@ 8C0A(B BBBD i 8A0A(B BBBE H`FBB H(A0A8D` 8A0A(B BBBG DhNp[hA``FEI B(A0H8FPX 8A0A(B BBBI D8F0A(B BBB `  \4hNH9\ p  <ED G qF H(A0\C A pF H(A0xثFDA V(c0R(B Y ABD K(a0M(F0q(A e(P0K(C A ABH e(H0H8C@N CABxTFBB A(A0G I } 0A(A BBBG @ I b A f P J D T N ^ B dЬL)BEB D(D0GPJXK`^XAP[ 0A(A BBBA RXI`aXAPGXM`\XBP48KFED a ABE KABp,8{FPD D(A0[8E@G8B0x8O@d8B08H@VHRPI0[ (A BBBE J8M@\8C0A (A BBBB c8H@g8A0 (C BBBG S8H@b8B0 8P@J @(E^(\vEID s DAF dBBE E(D0C8GPOXL`iXFP 8A0D(B BBBI JXG`dXAPTXJ`]XJPDXF`IXGPWXI`hXFP]XM`\XAPK8A0A(B BBB44HJDH l FBF mCB4lAEFP_ AAC aXR`HXCPhdFBB A(A0G L@I@@N@e@E@Q@C@t@A@Z 0A(A BBBD @M@O@C@N@y @K@O@J@N@q@K@H@A@I ~@A@H@C@N@x@A@H@B@Y@h@Q@K@A@p@;FIB B(A0D8JUBAIP\D 8A0A(B BBBD  FFB E(D0D8IK^Da 8A0A(B BBBJ xNWCIs FN K_B?N\Eh]PBHıhFBE E(A0A8G 8A0A(B BBBJ X TFBB B(D0D8Gpo 8A0A(B BBBD `xM^xApl 4YV WH_ I f4D sEAD N CAD a(g0H(A 4 &UAA DABBP XFBB B(A0D8DPl 8D0A(B BBBB XK`YXAPt/Ei 8̳FJD A(D@ (A ABBH (TEIGp AAI 84FEE D(I0r (A BBBJ p\OBBB E(A0A8Dp 8A0A(B BBBE  xPHCHGVpmxHKFDGQp(q L0^ FBE B(D0A8J 8A0A(B BBBI WjFDIAPhIDDANISNBAKMHIANsNIDOfGUMKPLBDA\QWFKbSHCSWSLAbTkFGBAN]WDDANKSPBAK`}FHFDBANZAIDTh RLBDAE  QAAJ ULBAKnQdAKUiEBDARDRQIDAR"BBE E(D0D8DpxFEPACDDVpaxRIBMp` 8A0A(B BBBH axRIBMpcxK`xAp[xM^xApWxTIBMp@$5K` I\\$VFBB B(G0J8MHQPFHA@X 8D0A(B BBBI sHDPcHD@%FBB B(A0A8DPXM`LhJpSPyXN`OhJpNPz 8C0A(B BBBD TXH`^XAPUXM`dXAPXK`8D((FBA I(DPY (A ABBK (*!EFD0 AAF +*DexĹ+yFEE E(D0D8DPCXe`DhBpIXH`QhLpDxEIPd 8D0A(B BBBH XI`^XAPl@-FEE B(D0D8GPXe`EhFpPXJ`BhMpMxAaP 8D0A(B BBBE ,0*HGC D(B0B8B@BHBPIH0FED D(D0n (D ABBB e(D ABB,1@EG qA8L1FED D(NPj (A ABBG @42LBEB D(D0D@ 0A(A BBBG \̻@3zBBB B(A0D8D 8A0A(B BBBK mHAAZ,`4BFGB B(A0D8G`hOp^hA`o 8A0A(B BBBK DhSpHxF\`phOp_hB`XhOpahA`{ hSpHxFJ I hWpH I hOpO I hOpO I hOpO X7BBA A(D0J (F CBBG j (C ABBF e(C ABB@l88FBH E(D0A8DM^Ab 8A0A(B BBBJ 9HgBHM^A4Ľ(?^EKD P CAH  CAE (P@AND0I AAB l(@FEB E(A0A8G  8A0A(B BBBG G^AXM\AG FEB B(A0A8DHBBBADABBX[ 8A0A(B BBBE DCgBCgAgHA HtPFBB B(A0A8D'R^AESBABAX@SBABAXJSBABAXJSBABAXJSBABAX 8A0A(B BBBA R`BFiBKFhATl0XmFJB E(A0D8D` 8A0A(B BBBI DhMpchA`hH[gFBE B(A0D8NSPMGABI 8A0A(B BBBA H0L^FJE E(A0A8DP 8A0A(B BBBE X|`eFBE E(G0A8GP5 8D0A(B BBBE XD`FXDPb b"bb0(b <b"EXXclc_FBB B(A0A8GOEDJHODDHBDALGGHANANGBBGNGAGGLm 8A0A(B BBBK ]EDGHQDDHBDALANBANBACBBABBAFGLnXEDGHNDDHBDALABBABBAABBABBAFGL0hxDhBHE E(D0A8GPiXM`RXAPjXH`cXAPH 8D0A(B BBBD YXI`gXGPYXM`\XMPZBA D(D0| (H DGKQ Xh0D(A ABBX>PBA A(D0J (D DBBB t (D ABBC W(A AEB0(t?yQAD J FAI DCA@\?FAA g ABF b CBA ACBH,@ FED A(JM^Aj (A ABBI LBFBB B(A0A8Dpx 8A0A(B BBBD \<BBEB B(A0D8D 8A0A(B BBBJ DWAtPG2FBB B(A0A8D@ 8F0A(B BBBK P 8F0A(B BBBA e8C0A(B BBBDHgCG _AAV D AAJ @CA4\HBAA G I `  AABH I$I IME[ H dPI\IME[ H dI$IME[ H dDI+0XIjEDG f AAH eCA J.0vFEE B(D0A8J\OD 8A0A(B BBBE lGbFuGHBBBABBBNZVAa ZE 4CFBB B(A0A8GpxQBBBBABBBSp 8A0A(B BBBD DxN\xDp^xeHxApE xYE XGFBE E(D0A8GPSB{ 8A0A(B BBBI VJKIAIMGGMLEBBBABBB\[FHOF 8A0A(B BBBK $YRAPNnFBB B(A0A8G I! 8A0A(B BBBF !J!\!B!!K!c!A!!R!O!A!P!B!A!A!Z!W!V!T!A!O!J!N!B!Z !B!A!A!E , \TEC DGH E PLX BEE B(A0A8G6HVBQ 8A0A(B BBBH BNXBMSAYZSA SE _ FLJ E(A0D8Jq[BxTHDBBIUFAW 8A0A(B BBBD IHBBBBJBEQkGQAiBEB B(A0A8G`hOpGxAK`hXpOxNI`V 8D0A(B BBBH ghJpbhA`AhKpDxBM`DhlFBB B(A0A8G L#a 8A0A(B BBBD #M#\#A#~#H#H#C##M#]#B# #F#_#D#4#F#T#A#(܈_ECDPK AAA _Ee F n<Pkdc U`X&BBE B(A0D8JFYBi 8A0A(B BBBI nHA{ADDPR`AHkAM^BFUADDDI/ZMBFjAT PP _ TJ 4 DE MJANK]A[TIEL`FBD A(G0 (D ABBA h (D ABBG p бjBBA D(G0t8Q@SHHPN0[ (A ABBA S8Z@_8A0w8Q@SHHPK0H(A ABBH̲TBD A(D0iH0d(F ABB| @t=FBE E(A0A8DQMiBXQVDToLTGTOgBHPfAPgBi 8A0A(B BBBC P PP gAADT\ IJ KQRCTTWFPTWFBbWFPTmWFPTqWFBbBWFPTQMiAlWFPTgWFBbgWFPT WFBB lWFBbN WFBE YWFPTH WFBE dWFBbGWFPTOWFBbgWFPTgWFPTg WFBE YWFPTgWFPTyZaAcZaAohFAVHhTBzWFPTWFBbWFPT|WFPN^ WFBE VZbBpWFPTgWFPTk WFBE YWFPTMKFCJbC_B^ CE GFSAiOWCYc TDAAFJ iWFPTgWFPTp WFBE YWFPTCWFPTjWFPTnWFBbgWFPTg WFBE YWFPTgWFPTkWFPTv WFBE Y WFBE YWFPT\PfAcZ\AfWFMVhQKBbZaAhFAVWFMV\_AmMSB \E LFSAWFBbnFTBl QKBE VXaAHHAA\R HAAE v HAAE mMHAV{HAAb{ HAAF YWFPTgWFPTE_ZA{WFMVDHAVwX[AyFHAVBFHAVCHFAV~MHAVdXaAqfTBGXbBzHFAVtfTBPHFAVd_ZAdXaAo WFBE YWFBbdaYBbWFPTg WFBE YWFPTgWFPTgWFPTL AABE YWFBbg WFBB Y WFBE YWFPT$LjBdSFRTpWFPTL%@/FBE E(A0A8DPwXO`GhGpDxGDDIAIPXZ`OhBpBxDWPu 8C0A(B BBBA  XU`FhBpBxDG ^XN`KXAPLXD`hXAP&@&MHD } ADE TABIP H\& BBB E(D0D8DPS 8D0A(B BBBI 8&tFID A(D@ (A ABBA 0&HBDA D@u  AABD \'PFGB H(D0H8DPVXG`mXAPXL`aXAP]8D0A(B BBB`x'4BEH B(D0C8D@vHLPmHA@P 8D0A(B BBBG _HLPuHA@\'\BEH E(A0A8Db 8A0A(B BBBJ vPKA(<(nAID m DAH h(|(bES H H($iBBB E(D0D8DP 8D0A(B BBBK 4(HBGF E ABI dAB0)|AFM o CAI eEAP)aHX\h)DFAA (H0b(A A ABJ t(P0[(B L(R0K(L (P0Q(B ()E@H bAA G L)XFGD O(M0a(H Q ABF s ABJ nABlD*FBD D(N0K (H ABBJ j (C ABBF h (C ABBH e(C ABBl*tFBB E(D0A8D@HNPgHA@Q 8A0A(B BBBA t 8C0A(B BBBH D$+FED D(D@Q (A ABBB LHXPHHA@8l+`FBH A(D@f (A ABBG d+#FAA U CBF T ABA K(C0g(C A ABD G (Z0G G(_0O(A \,(FAA M CBF T ABI p ABE D(F0h(A I(F0h(A (p,\8FDA iAB4,plEIN0x CAH  CAG D,FDA S CBE K ABJ f ABG -C00-QEHD h FAH DCATd-FED H(G0X (F DBBD u8M@\8A0F(A ABB-FBA A(G@^HHP^HA@D (D ABBE WHMP\HA@G (A ABBJ  (F ABBF n (D ABBI 4H.ZFDH y ABB CDB.E.YES.*. >4.LJFAH m ABA FAB4/drFIG J ABE FABP/d/(HRH|/0FEJ Q(H0K (D BBBE H(D IBB(/fFDD d ABK />0900 00<EG G AD T04h0FDA G CBI dAB0<FEB B(D0A8G`h[pFhA`D 8D0A(B BBBG ]hYpThB`m hPpO DhFpMxVN`IhFpmhA`m hZpL K hPpJ @1< }EK H d4`1 iEDG0g8f@O8A0X AAI (1 FHD AB(1 >FHC iAB@1 EDD j CAE W CAE D(T0Y(A 42H *TH2d FBB B(A0A8DP} 8A0A(B BBBG XI`^XAPH2,BBB B(D0A8DPy 8D0A(B BBBI H2FBB E(D0D8DPz 8D0A(B BBBF @834EAG | CAC V CAF u CAG `|3FBB B(D0A8D@zHIPzHA@ 8D0A(B BBBE THNP_HA@3 d3FBD A(N0C (F CBBE u (C ABBC L8N@\8A0F(A ABB\4@p4LG\j4I84FAD ] ABE  ABF 4dHN44lgDJ Y CAF DFAE8(5FJK A(D0M (D ABBJ (d5ANAD iAAB$5=EDN _AA5FLE B(A0K8LkLGFCkA[ 8A0A(B BBBG O[A OU | FV OTII} VJ h6FSB B(A0K8GNaEpMYBl 8A0A(B BBBJ M\AaN[Dd6`FBB B(A0A8Gpy 8D0A(B BBBE UxKmxAp!xM\xAp0d7 FAD GP  AABA h7D!?BEH A(D0h (A BBBE  (A BBBK e8F@h8C0A(A BBB8"H8"FBI D(A0 (D BBBG T(A EBBDd8"FEA D(GP (A ABBC dXF`jXAP88$ZFBI A(A0(A BBBL84$FBE B(A0A8G2 8A0A(B BBBD 89%LL9%FBB E(D0A8D' 8A0A(B BBBG <9@(PBA A(D0(A ABBH09(iFKD D@  AABI :*En M b F H4:h+FEB B(A0A8D@B 8C0A(B BBBE ,:+FDI h ABB :|,3:,#:, @:,FBB A(A0GPl 0A(A BBBI \0; /FEE D(D0k (C BBBD b (C BBBE T(C BBB\;/FBB B(A0A8DP 8C0A(B BBBF D8F0A(B BBBD;<0FBA C(G0P8O@k8A0D (A ABBH d8<0BEB B(D0A8IP\ 8C0A(B BBBG OXJ`QhRpTPXH`lXAP(<|2JFAD {ABx<2FBA C(G0G8M@Y8D0d (A ABBB K (C ABBE k (C ABBE [8J@c8A0LH=D4)FBE I(A0 (D BBBF e (C BBBA ,=$5sJa E LM \DAF=t5s=53TNL=6XFEB B(A0F8GCoAkMdCVJdBPM_BwRcALeB`OBf 8A0A(B BBBJ fHFIHP_EOGnAcOAD^OAPXEEKT^B/CIBN\C JV F]AwMcA_ LQ D KV @JWRIv LX t LQ ER[AMcBi FE AO`Hf TJ DGnAGoB FE D@LFBB B(A0A8JD]B 8A0A(B BBBH NTHPIeATHAFmET@Z'FBB G(A0A8DP 8D0A(B BBBA LXk`HXAPHAZFIB E(D0D8DPXI`^XAPt 8C0A(B BBBG XXI`^XAPx 8F0A(B BBBA p8F0A(B BBBAT\3WUlA|\{FBB I(A0A8DHpHhHgAv 8A0A(B BBBF `B_TFBB B(D0A8DGRMOSLA] 8A0A(B BBBC LHMIW[ HMIF L HMIE  C@aFEB B(A0A8GEFAnPaBKLCKuRLDDHjEKaAIsASKcA 8A0A(B BBBI MVAKLCKCGBXMYALMVAPaB0N[BMN[AU MO 0I_B^ JN QXXBaM\BlQ^AN\AQN\B9FfA,YYA{ IJ E~NH(`0K(A T A LDE~FBL A(A0 (A BBBG `(C BBBE(EAC DFJ H hEBBB A(A0G I x H ^ D  0A(A BBBK H e H A ,@F<AC DGKv H DpF FBB B(A0A8DP8D0A(B BBB(FAJF0H AAE HF(BBB A(A0 (D BBBC G(A EBB$0GmAm B L L dHXGBBE E(A0H8NP 8D0A(B BBBI \GBBH E(D0D8GpE 8D0A(B BBBF ExDDDIp@Hȍ;BEJ K(D0Gz 0A(A BBBG 0HHĎAC BEEEDs D |H0AO H H& HKKW F UK HEN f AF LHĒFBA A(D0O (C ABBK V (C ABBB 4HI4EDD _ DAG [(M0\(A 0IIFJ e CAF mCA`IH~BEJ E(D0A8D`hJpKxDABN`m 8C0A(B BBBG JdH0 G m(8J$sEAD } DAD \dJxMBEB B(A0D8GdHcD 8A0A(B BBBG dJh]FBB B(A0H8DP 8D0A(B BBBA \XM`\XAPsXN`OhMpIP ,K`bTZdPKcdKX'HQ G F<KhFBB H(A0x (D BBBK 8KFJA D(D0 (D ABBA HLFBI B(A0A8D@ 8D0A(B BBBD LL@$`LL8EGG XGApLdV BBE B(A0A8DHPKI~ 8A0A(B BBBA  H`GdLPFEB E(A0F8FpBxKSxAp 8A0A(B BBBF Lx[WxDp8dMȯFLD C(G@Z (A ABBH xMlQFID A(D0z8E@V8A0\ (H ABBI s (C ABBE v (C ABBB h(C ABB`NPFBE G(A0D8GP~XJ`JhBpAxEIP[ 8D0A(B BBBE N̳nFEE B(K0C8Gpa 8A0A(B BBBF xLOHABIpWxKTxApxI^xHpcxITxApOFGE E(A0D8LPpXM`IhGpAxDQPXXJ`QXAPY 8A0A(B BBBF dXD`UXBPKXJ`QXAPX 8C0A(B BBBF m 8C0A(B BBBG c 8C0A(B BBBI OܹFBH B(D0A8D`\ 8I0D(B BBBL  8C0A(B BBBD  8D0A(B BBBL a 8A0A(B BBBE LxPԻCFEE D(A0G@QHNPNHA@Z 0A(A BBBD PԼFDB B(A0A8DPi 8J0A(B BBBH h 8C0A(B BBBD T 8F0A(B BBBM tXL`^XAPPQjhQakm0QEDD B GAI pCA4QdFAD M CBC rLB@QܿFAA x ABE q ABD dABT4RVFBE E(A0A8D@ 8C0A(B BBBF PHdPMHA@XR FBB B(A0D8DP9 8A0A(B BBBH XM`\XAPLR<FAA q ABD _(M0^(D A ABA p (A0B 8S%LSNBB B(D0C8DPXN`KhMpIPI 8A0A(B BBBD m 8F0A(B BBBD s8F0A(B BBBFHP`XK`^XDPS4FBB B(A0A8JNQA_KPA 8A0A(B BBBC =DBBI<T<FBK D(G  (A ABBH TrFJL H(A0A8D@NHIPiHA@e 8A0A(B BBBF HFPIHA@mHMP\HC@QHFPJHB@o8C0A(B BBBTTUFBB A(A0GIhDG 0A(A BBBF DUpFAA JmL_CP  AABG <U BNA D(G; (A ABBC D4VWFFA G0  CABD ]8J@BHAPN0|V6RSKVEU8VFBE D(A0(F BBBV|+(W=EDG R GAF 0WDW XWlWWW WW WHIW WKH } A X$-,X@HEg D SLXp `Xl tXh Xd X` X\ XX XT/HW I FXddH V A Y (Y!E[DYXY lYL@DE8Y<FBA D(J0r (D ABBF Y/HW I FYaH J F ZD,HV B G(ZT!0FAA mFBg4`g h|S$h,Dg,@@o<>GAA p(L0^(D J CBJ `CBo>o>yUY4o?BDD z ABI JAB,o?lAC FM2 G pS8,pS9BED D(GP (A ABBH hpTKD] G DpUBBB B(A0A8D@8C0A(B BBBlppUBDB B(H0H8D` 8A0A(B BBBJ xhIpghA`v 8F0A(B BBBB HFHC iAB(p2>FHC iAB<2lEAD N CAD P(F0i(A IAA0ܕ3EDG } FAD KCA$|32EDD `CA483YFAA z ABK CCBp3 343jFDH J ABA CDBЖ3EHQ k04!LL4_ERD | AAG G CAE h CAD c(M0\(C HP\5WFBB B(A0D8F` 8D0A(B BBBI @p;ECG n AAA l(M0\(C w CAE @<<ECG j AAE ](R0Y(C t CAE $FEH B(A0D8GP^ 8D0A(B BBBD LXH`bXDPiX^`SXBP^XF`iXBPXE`IXAPXXP`^XAP\ XM`L DXI`\0B'tHB$dB'B%BEP̙BFJI B(D0A8L^SBOU[A_[Bg 8A0A(B BBBA mbWBoFNAHKMHPS PJ lFFEA D(QP (A ABBG u XP`K TXM`\XAPN XP`L TXM`_XAPc XP`G 4HiEMG i GHO { CAA ,4JyFOM  HRP @dhKFDD E ABJ g ABF dAB@KYFBB A(D0GL 0A(A BBBF (MVAID [ DAB H4MFBB E(A0D8G` 8A0A(B BBBD ddNzFEE E(A0A8G` 8M0D(B BBBG  8D0A(B BBBE 0̜ RjENI M CAC uCA(\REND r DAB ,R8DxSnBBB A(A0^(A BBBS8FAA G L@I@@K@`@B@`  AABG Q@M@Y@A@@H@]@K@I@K@M@Y@A@N@L@K@C@P@\TVFBB A(A0G L@I@ 0A(A BBBF P@M@T@B@Y@T @M@T@H@G @ @H@O@I@H Z@M@R@Q@I@^@M@T@O@I@@H@H@H@W@P@I@O@O@W@M @H@H@H@E H@K@P@H@W@j @F@H@A@E f @D@H@A@J [ @H@H@A@E Y @F@H@H@E Y@F@H@H@@xZEG W AD P(M0T8T@K X(M0T8P@I [FOG B(D0D8GMTA{IOJNr 8A0A(B BBBF xO^DgxD]FDA Jw  AABH DL^AgPKAsHOJNyMOCN _XKG A ܠP_vEIt AE l_4EAD  DAK e(I0O8A@\ G AAE f(M0O8C@N a MOP e (F0O8A@M p|aFHE D(D0D`h_pHhF`H 0A(A BBBD JhMpOxCN`GhMpTxCP`khMpTxDI`HcKEL\Pt AAE PXM`ThPpIPXXH`ThRpIP,@dED G fM O(C0NFp\e LXeuAN_U AAK tTOA_TOAxԢfBBB B(H0A8DPXT`MXAPbXR`OXAPL 8C0A(B BBBH D8F0A(B BBBPgaBLB E(I0C8QlGPBTOA 8A0A(B BBBK cTOAtMOCNsMOCP,jKAC DEED H (k <kFEF B(A0D8DPE 8D0A(B BBBB XJ`QXAP[ 8F0A(B BBBE XK`HXFPXc`IXBPȤTn+E_hn dn  `nIKQ D h,n @n Tn hn |n |n xn tn ̥pn lnxn tn pn0|n HDxnEGF m MHL Q OJF D AAJ IPC\dBFEB B(A0A8D@Y 8F0A(B BBBC p8C0A(B BBB 8CHV B j F ICG,CEID e DAD ,PD@\D TXDhdDRE[ H iDNE] F _ DEZ A H@EBEE E(D0C8DP 8D0A(B BBBD |HBEB E(D0F8D[LEKSKTAH 8A0A(B BBBH  GQ pOBEH B(D0D8NBBBI^RUB| 8A0A(B BBBI ( TAADO AAI H8U9BJD D(D0m (F ABBH (C ABBVFBB B(A0D8GuMOCN 8A0A(B BBBI KPYAjIOA\X MTCNwKHAE C_IBACNlM\A[_IBACN(]DP]XD`GhApLPh G $0^\p D QN YJ^RBLE B(G0A8G_bBN\HBB]T 8A0A(B BBBH tIBB]\`BEE E(D0D8DpTxPBBIpC 8A0A(B BBBE MxHBGNpxxZBGNpa?A] B Pa]Al K dH Hl I8AHo IT+HH ZpFEE E(A0D8D@nHKPNHA@D 8A0A(B BBBD DHPPMHB@LHhPFHA@I8A0D(B BBBDHFAA J ABK j(X0F(D \ ABE < P dx4yAOG  EDM (M0\(A HaBEE L(D0D8DuKMOHFDDIvKKDIULKDITDDFFFNMDDDIDDDDIc 8A0A(B BBBK tODDI@LNDIN_A  0mH`P H \h_pDxDDAY`8:TF F(F0StXmFAA B(G0o(D K DBK j(M0Y(D q CBF D(M0Y(E N ABH (M0Y(D FBB B(A0A8DeC\DPIMDImKKDIdDDFFFNWDDDIDGDDAKKDIp 8A0A(B BBBG ZNeABBE A(D0GQDDIZDDFFFMDDDD\h 0A(A BBBA DODDIrHDDIxBBB B(A0A8G L"B"z"C"B"]""O"P"D""N"\"D"[ 8A0A(B BBBG a"N"\"B"0< _ADI P CAF rCATDh 9BBB B(A0A8D@| 8C0A(B BBBJ IHKP`HA@pP BBA A(DpF (A ABBJ rxGODAHIprxDDDIpQxT`xAppl 6BBA A(DpD (A ABBD rxGODAHIpexT^xApDxDDDIp85BEB D(D0DplxNHHNp_xDDDIpZ 0A(A BBBE wxTYxAp xSQ d xSQ @fBDD T ABG J(]0O(C AAB@TBDD u ABF J(]0O(C AAB@dfBDD T ABG J(]0O(C AAB(KDDD tHBBFB B(A0H8D@HMPfHA@L 8A0A(B BBBD j 8A0A(B BBBL m 8I0A(B BBBE hBBE B(A0A8DmLIAHHKANAMAIAHAAw[WKFDAINDDDIf 8A0A(B BBBD _gAHHMAIAHAAqSMhADDDDIrDDAWT XOIAHAAn[RDAE BBB B(A0A8G 8A0A(B BBBE CNBmAMROIAHNDDDIS[ATTXBNFH    Ht D 8$ H`N J zhIpDxDDAY`U J ` ,JdF F(F0S\ \5FBA A(Dh (A ABBD cI[AjDDDIL < FDD p ABG J ABK H DBJ eCB$0! mEo L A G O,X!$!FFE H(D0D8LxbHBYCNHFHIAIAAAMPjDDDI` 8A0A(B BBBE MHNHMHIABAIHNNENAK[Av PL T PL D PL d"t&FGD I`lhHpYhA`BhHp`hB`WhDpDxDI`Z  AABB PhMpbhA`8",(@EAD`~ AAF |hDpDxDI``,#0)(FBB B(D0A8D`W 8A0A(B BBBJ hJpNxBABI`d#,>FBB B(A0A8D`?hHpHxIABI` 8A0A(B BBBE #2FBE H(G0D8G`hMp^hG`UhMpYhA`BhDpJxNABI`r 8A0A(B BBBC KhMp_hA`hMp]hB`JhIpchA`I hNpI P$D8FAD I`UhNpHxHI`_hDpDxDI`V  AABB $8 FBB B(A0A8GMeBsDMPHIAKAIADAHSGGGIQ 8A0A(B BBBE RTBPTBp0hPBxDDDDDNT SR iMGGIEGIDDDNLO`AB^AQN`AYS_AU LS IIuAISZBI LS ^ LS U NQ &0BFEE D(D08B@N8A0C (A BBBF X (A BBBI X8j@I8D0A (A BBBI } 8S c8[@W8B0 8W X 8[@M H8f@H8A0] 8[@E `'LhAIGP AAG 4L>!EDJ v AAE [ FAF (>EIG r AAG @> EMG o CAD c HAD c HAD l>FKE B(A0A8Gpx`LNTp0 8A0A(B BBBB YxM\xApdd?FKB E(A0A8D`' 8A0A(B BBBA  8F0A(B BBBF 8?@FDH W(U0_8B@I A ABD @/HM N(B0I(@/HM N(B0I8H@FDH W(V0X8B@I A ABJ \@FGI A(G0[8M@NHKPI0K (C ABBE E (J ABBL T@FNM D(D8A@HHBPI0K (C ABBH v(G DBB|BBE D(F0D@s 0A(A BBBF hl>BBE B(A0I8DpxJ_xApp 8A0A(B BBBD x^OxAp8mBZHQPmCZHQhmdCZHQmCZHQmCZHQmFHA D(D0G (C ABBJ E (F CBBF c (F CBBH D8J@e8A0hVFGB G(I0A8JnSOJI\BBNP 8A0A(B BBBJ oMULEEIdFBB B(A0D8LKPIDBN] 8A0A(B BBBF Dd({FDH P(M0K8D@I A ABE bFB`_D0U A HȀ1BEB E(D0A8GP 8C0A(B BBBF lBGG B(D0D8DX]`KXBPZXT`[XAPX 8A0A(B BBBD $Xh`HXAP8BBA D(L0 (D ABBA XLFBB I(A0A8DMTAg 8A0A(B BBBE LFBB B(A0A8DF 8A0A(B BBBF PlbFBA A(D@HSPKHA@Y (A ABBH SHLP`HA@tFEB B(D0D8DpxMTxBp-xFOxApN 8A0A(B BBBG xL`xAp8`FJE E(D0D8Jw 8A0A(B BBBC kH[BYCBIFLEI|ăX FBB E(A0D8M 8A0A(B BBBD  RL MYAGhAdD"FBB E(I0A8G`hMpZhH`}hMpGxBI`f 8A0A(B BBBK H{BJD F(D@y (A ABBG T(A ABBBBE B(A0D8GP{XP`QhIpIPFXO`UXBPBXB`fXAPBXB`eXAPYXP`ZXBPPXI`^XAPJ 8F0A(B BBBD tXI`^XBP\XP`QhIpIPGXP`RXAPBXB`eXBPBXB`fXBPMXN`ZXAPOXL`bXAPQXM`]XAP(ADG  AAA T  {BBB B(A0A8G L@LAK 8A0A(B BBBB Xx4BBA G(D0@ (A ABBJ D (C ABBD D(G ABB|Ԇh, BEB B(A0A8G 8A0A(B BBBC @F[LDCIG`A TAG U AB xAG U AB |PBHE E(I0D8J_MFIFaF 8A0A(B BBBF DMWC`VTlG NH<BBB B(A0I8L@9 8D0A(B BBBD  BEB B(A0C8G  N \ B N N \ A Z P _ A } a F F Q c B B Q  F a B P M Z A  S _ B  N I D B B U o 8A0A(B BBBF t N G A S F N G e G e B q S _ A ] O ` B   S Q  [ H E P   N I D B B M D P ] E } M P E P ^ N Z A I P N I I (T\BKG DAB  BBB J(D0J8NIYCeDeBMYASMZDfEfBIYCfCfBu 8A0A(B BBBC MYCeCeAQMZDfEvACMZCeDeAxBEE E(D0I8GkOFFNP 8A0A(B BBBE {LFFN\FDDBJX@ FDAF \LBBB B(A0A8Dp]xVFFWp 8A0A(B BBBD cBFB E(A0D8JIII[HFADDOSN 8A0A(B BBBE JMZAcnA\vAIK_BL KI   KT $8/*FBB B(A0A8G L&} 8A0A(B BBBH d&H&\&B&z &H&L ~&M&_&A&t&I&I&I&p& &K&U l &E&G F &M&U &I&`&A&&I&I&I&`&P&a&G&G&D&D&I&Z&T&L&A&D&D&I&&I&I&I&^&h&B&I&I&S&@&I&_&B& &R&_&A&I&R&`&B&H&I&`&A&W&I&I&A&B&B&N&|&O&T&A&D&N&g&D& &O&E N&I&I&A&B&B&N&&N&`&B&&O&k&D&s&r&F&H&\WFBE E(A0A8J 8A0A(B BBBH KcF\FBB A(G0 (F BBBC I (F BBBK u8F@I8A0}8F@I8D0Z8F@`8G0A (A BBBD I(F BBBD]FDH m ABF >(B0F(A j ABE H_BEE D(D0\ (E GBBH e(C BBBHHD`FED G(D0V (C ABBH J(A CBB`!`QFEB B(A0D8G 8A0A(B BBBI CO^AEDBNMYAHPB`@tFEB B(A0D8GP 8C0A(B BBBE D 8Q0H(G BBBF dHv FFE I(A0G BFD 0A(A BBBG yGFD@ zEDD t AAE p CAD k CAA P{GET G fXp{>FBB E(D0D8Gp\xOUxAp 8A0A(B BBBC <̓~FBA A(G (A ABBG \ pFBA A(D0\ (A ABBH h (F ABBE c(F ABB\l0FBB A(A0GPXA`SXAPcXF`PXAPf 0A(A BBBH ̔^FGB B(D0D8D}KDACBI] 8A0A(B BBBA  TMMABIpIMON<hdHAAG L! AAE l!J!`!C!ttBAA G I   AABJ U M c B ` T O A K j H B O b H A \ ܈3BBB E(F0D8G 8A0A(B BBBK TOADFBD G(G0R (F ABBI 8M@\8A0@ȖBFB H(A0D` 0A(A BBBA BBB B(A0A8G I!!R!N!A!v 8A0A(B BBBD U!T!`!C![!T!O!A!n!F!R!B!V!b!I!B!| BBB B(A0A8G I g N b B ` R K D z 8A0A(B BBBH W T O A |0BBB B(A0A8G L& &F&]&D&I&j&L&N&D&p 8A0A(B BBBH D&E&T&C&_ &N&S I&h&I&C&&G&E&D&D&A&I&H &Q&S f&O&T&G&@ &B&F c&K&[&D&I&`&M&J&A&W&] &O&O Q &Y&B&A&K P&b&D&A&I&]&N&N&L&D&D&I&c&b&H&A&V &M&L&A&E BBB B(A0A8G L""D"@"E""O"U"A"x"L"b"A"c 8A0A(B BBBG D"M"k"B"V"G"F"A"I"a"_"E"C"P"I"L"i"A"|`BBB B(A0A8G L##I#^#D#[#{#j#B#}#b#M#B#I 8A0A(B BBBA }#P#Y#A#H#U#B#E#\#B #N#I#A#G I#K#P#M#I#V#N#Q#K#A#A#I#h$BBB B(A0A8G L!!T"O!E!C!R"O!A!X!L"_!B!X 8A0A(B BBBE G!T"O!A!j!R"P!A! 0BFB B(D0A8JH_CXK]AM\BC 8A0A(B BBBD H_BH^AH_BsI^AH^AY KL bLMAKLND\ KT QI^AV MT A KT ZI^Bn_GBI KL QH^BX KL PIcBxFFB E(I0A8GAIA}KGGBBNf 8A0A(B BBBE L 4EAG I  AAK \ T O A L M ` A p5BBB B(A0A8G L@LACBMAHAPAPBIABAoATBPABAATBOAAApATBOAAAZ 8A0A(B BBBA DAMB`ABA$8FBJ E(A0A8J 8A0A(B BBBB *I^A2^OAL^PBN^OAJ^PB9H^A{MIBI8I^AkI^A`LB_GUB^ LS a LS nFHApMHBwFIAhFPBWUA LL PRAlNUB[`MAZPRBU GE U GE kPHAAHh P4HHT\`p\XT4PRFDI i ABI AFB4xRFDI i ABI AFB4RFDI i ABI AFB4TRFDI i ABI AFB@mJAG e AAG  AAG rF `ТwBBB F(A0A8D` 8A0A(B BBBH m 8C0A(B BBBA <48FsK J(F0Pp D YF kCA J (tHYJ B(B0IO I x( {HRI F(B0IO E pḤ`BEE E(D0D8I@d 8C0A(B BBBF 0$ BDD D0q  AABE 0LQGG |(H0^(A DAAT\BEE D(A0QKFBIw 0A(A BBBC ؤ \($BEJ E(D0A8JKDBIz 8A0A(B BBBD ĥ`إ~BLL I(A0D8G K J G A I z 8A0A(B BBBG <#HH RX#HK Ot HH O &HK R, EVJ E(B0IR I u<ܦDF N _ I WI LAD G j F N J @ NBBE A(A0GP 0A(A BBBI L`,GBJG E(A0A8G 8A0A(B BBBE ,BEE B(D0D8DpexYCDEEEEIp 8A0A(B BBBK xKJAIpXxAQxApP xL pxHJGIpV xI a xL Th3BLE A(A0J 0A(A BBBH D[EBI<|=FEE D(A0x (C BBBJ H|LFBJ E(D0D8G 8A0A(B BBBA L(`9FDH TAD(TFDH lAD̩xFIE A(A0JGGEEEHHi 0A(A BBBA mIeA pED h AF HNHNĪ&E`H BJB I(A0K8D@r 8D0A(B BBBJ L,BBB E(A0A8G 8A0A(B BBBA \| BEB B(A0A8G 8A0A(B BBBH aOYDܫ BEE E(D0A8F@ 8A0A(B BBBE : 8C0A(B BBBJ y 8F0A(B BBBH HMPMXF`N@lHNP[HF@HxDKBBB E(D0D8D` 8A0A(B BBBH HĬHBBB E(D0D8D` 8A0A(E BBBI DBBH E(D0C8F@a8A0A(B BBBX lMBOE B(A0A8G`xhKpehE`hMp]hB`h 8A0A(B BBBB hKp[hA`hZpIhE`[hMpYhB``hJp\hC`thUpYhA`\JFNR G  AABD RHHMrQHHKHt FBB E(D0A8Qp{ 8A0A(B BBBF Hl BEG E(A0A8D@x 8D0A(B BBBB 0 @!AKD t DAG kCAH@!FII B(D0D8G 8A0A(B BBBC H# FBB I(D0A8DP 8C0A(B BBBA 4د#NDO c DAG @H (L$QFG K AAE \<%8FBB D(I0G@ 0A(A BBBF wHLP[HA@HNPYHA@d*HFBE B(D0A8GP 8A0A(B BBBF XN`\XAPXM`\XAPL.FBD A(G0M (G FBBN l (A ABBF XT/EFBD A(G0O (F CBBH U (C ABBK P8F@I8A0<0FBH D(D0 (D BBBD @1EDG ` AAF Y FAH h CAD H41FEE E(D0D8G@ 8C0A(B BBBC 4FEE E(I0D8G@[ 8A0A(B BBBB s 8C0A(B BBBA HNPYHA@F 8A0A(B BBBC H 7kFJE E(D0A8GP 8C0A(B BBBG HX;= FBE B(A0A8Dp 8C0A(B BBBG \DFEI B(A0A8G 8A0A(B BBBH NYAThMFLB E(E0D8DP XM`\XHPb 8D0A(B BBBA h\NFBB E(A0C8G 8A0A(B BBBE -DDDDDIlȴTSFJE D(A08e@H8A0 (C BBBE g (C BBBH } (C BBBJ D8U[FBA A(D@ (A ABBE |HLP`HA@4VEDD k CAD g CAE 0WFIA G`  AABI @X9FJE A(D0D@{ 0A(A BBBG H0XNDG \(F0F8F@FHFPI Y AAI @H 4|YFAF J ABF r ABK 4YFAF J ABF r ABK 4PZFGA K ABD u ABH $Z FEE E(A0C8JMZA`MUBSF]AGGGGGI` 8A0A(B BBBK GGGGGIJHDHgFEB B(A0A8DPi 8A0A(B BBBH D<PhFBB E(D0A8DPs8A0A(B BBB@h`EAG u AAD  FAE D FAE ȸjHFEE E(A0A8GQaXAp]DCNCqBI^AdKfB&I_BXH^AjIbBiI^DliIBGGGGGIe 8A0A(B BBBI  LM VH_BzK^AV NQ | KQ K_AmHAaTB\FEE E(D0A8JsGGGGGIa 8A0A(B BBBB OIB`R]AVIbB^MVAGGGGGIY QlH8ĘFEE B(D0D8J  G G G G G I b 8A0A(B BBBG . L b B Z ] q A L I U A  M Z B F M Z E  G G G G G I A J G G G G I  N [ H O N [ H O N \ I  G G G G G I  M G G G G I  G G G G G I { G G G G G I hܼ FBE B(D0A8GDDDDDI` 8A0A(B BBBG 0HEIG e CAB CHAP|FAI % KBF J ABK q ABD w(I0^(A @нlf!FIB B(H0D8Ja 8A0A(B BBBD LbE2IbAIcB~M[BM]DN\AWfRAL^DafSB5IdEN[HvIKBH^GCeA|FBB B(I0D8GP 8A0A(B BBBK H 8F0A(B BBBI e 8F0A(B BBBD L8FEF A(G@EHVPDXB`I@u (A ABBB \BBB B(I0A8GNaDr 8A0A(B BBBI DDHFAA G0  AABC 48J@Y8C0HBBB B(A0H8DP 8A0A(B BBBH tEX C c E DFBH D(G0o8P@[8F0D (A ABBK `D*ECL Q(J0\(D f CAG { CAA D(L0c(A F AAD eCA4EKD e CAC Z CAB $DEo D s E d805FBG D(D` (A ABBK Xl`EKG U CAH u CAG e CAG S(H0b(A F AAB WEe F fWEe F f|DTFGB B(D0A8IP 8A0A(B BBBK  8F0A(B BBBE XN`WXAPZXM``XDP4$BAH  CBJ iFB@FGB A(D0G@d 0A(A BBBI dFGD A(I08K@j8A0W (F ABBC e8M@Y8A0 (F ABBH Tl` FBE E(A0A8D@M 8F0A(B BBBD HEPIHA@qFEE E(A0A8DpxO]xBpjxZUxBpgxEIxAp\ 8A0A(B BBBA DxGexApmxILxBpXXFGB E(A0D8DP 8A0A(B BBBK XP`QXAPX(FEB J(A0A8G@vHMPKXE`I@Q 8C0A(B BBBG \FGJ A(D08M@NHEPI0P (A BBBF g (A BBBB Pp<)FEE A(A0G@vH^PBXB`I@C 0A(A BBBK T FEF A(G0N8M@JHKPI0R (D ABBC n(D ABB p Ec H e K @@ FGD z ABB g ABF iABDX yFDH P(K0B8B@V A ABE D(_0B8B@\ N FBB B(A0A8GQYDL 8A0A(B BBBC L,EIG \ FAH L FAE I FAH N(G0Q(C L|PFDH m ABF (M0J8E@I s ABE lFBB G(D0 (A BBBA b (F BBBB h (F BBBD M8M@`8F0D<pHDH x(M0M8E@I A ABH e FBC tFBJ D(A0J8W@O8D0J (A BBBD b (F BBBB 8N@Y8D0t(F BBB FBB B(A0A8DP{XF`aXAP 8F0A(B BBBG DXF`cXAP_ 8F0A(B BBBD h8F0A(B BBB`<FBB B(D0H8JLIBSi 8A0A(B BBBG DvFGD  FBE J FBF h FBH D<1HDH I(M0M8E@I A ABG e FBC  FJB E(A0F8J 8A0A(B BBBB (M\G IP ]TBCKKHN^EX,5FFB E(A0H8DqnKA] 8A0A(B BBBF Xd7KFBB E(I0A8GPXp`BhBpIPr 8A0A(B BBBG (X:"BNK } ABE \;L FBB B(A0A8G} 8A0A(B BBBD MwE`LAEIA0(FEIG m CAJ [HA@FyFDE P(M0N8D@I A ABE `FB4 FTFDD q CBD FADlDGBIB B(D0A8DHiARR^A} 8A0A(B BBBD |IFBB H(A0D8DPU 8A0A(B BBBF  8F0A(B BBBI L 8F0A(B BBBE l4LSFBB E(A0H8Gp 8A0A(B BBBF xXBBNpxLKxApLNFFJ A(D0G` 0A(A BBBA UhLpThA`DQFDC x(l0B8B@I A ABF ` FBH 0<@RbAKI M CAJ mCAp|RFBB B(A0A8G L@IA0 8A0A(B BBBD AQAZAGAAEAIAFAdACAJAPAUAAPAZABAwASAUAAAX WnFFB A(A0DZGBI] 0A(A BBBE @|ZFED H(G0e8M@`8D0I(F ABBZFEI A(G0N (C ABBF Y8M@KHEPI0j (A CBBG k (C ABBE j (C ABBF k(C ABB`T[XBEE B(D0D8DP 8A0A(B BBBF D 8F0A(B BBBE T\XBEE E(D0A8D@X 8C0A(B BBBB MHMP^HA@]7FBJ B(A0H8J* 8A0A(B BBBE M\BDTA DL Q^A KE v DE {LEr I { {{ { H({FEB D(A0J 0A(A BBBJ t(~ $~ ~x~FBE E(A0D8GPx 8A0A(B BBBH U 8A0A(B BBBI  8F0A(B BBBA 0Lf4DEDD m DAA j DAA (| AFDD oAB4DRFJD l ABE FAB4lRFJD l ABE FABHFBB E(D0D8GPy 8D0A(B BBBD dK A (| EDG N AAH L`EDG u AAI [ AAC d FAE K AAC 0LEi B [(`kFAD y ABI @HFBE A(D0D@ 0A(A BBBJ PK A 9ES H P EP0 FEA G`  AABD 0&H]LHԊ FGA G  AABE IDDGGGI4EJTGGUa AA \FQP B(A0D8GP@IBRMTTXSDDDIV 8A0A(B BBBJ QDODRQFkEZIOJOI]AzMOCL}DCAaDDDa@EAD E AAO T(M0R8O@T DAA0(tFDD D@r  AABH \@fH0X A ,xKTGGIW A D&H]LXFBB B(I0A8LF 8A0A(B BBBF L.FBH E(A0C8G 8A0A(B BBBI d4E^ E  3Ԗ"" gh_ H FBB E(D0A8D` 8D0A(B BBBC l0BBB B(A0A8GW\C^ 8A0A(B BBBE AHHCPtFHCMMFHCK(%AAGB AAC ,4[F \ AB L FF dxBBB B(A0A8G L!P 8A0A(B BBBI !N"[!F!!J"h"F"L!{!I"O"A"d!!M"O"C"L!} !I"O"A"Q a!M"O"C"h!~!M"O"C"O!@|DQXAY(twBDA cJBTܤ+BBB B(A0A8D@N 8C0A(B BBBH HGPcHA@H FED D(D0o (C ABBB l(C ABBXeE@ K QxTEi J yjMK ZX$`CQYA MAC4uo ̨4ȨHĨ0\Eu F F J KE aDA J LXT`\LMoLFEA A(Jy (A ABBJ HMA0HDrEDG f AAH mCA|HFEE D(D0t (C BBBK l(A DBB,@T(h4|@ <~d E A SpFEH D(D0[ (A BBBC r (A BBBG s (A BBBF L (A BBBE 8ĭ L ` <t#FEB B(A0A8G 8A0A(B BBBD yMdA~HEFDGGGGGGGGALGBANGFBIBGAcABFFFIABHOvBtBDIEFGNGIDFDIEFGNDIDFOZQTWL`^OA?BpBuTLAJB\BgPBAFF\NIUMII PBAFFE xMOCKkO`DpH)BEA I(Dp7xAFGBADHGGNpf (A ABBG xM`xApL(FFA A(Gj (A ABBK TFAx"HYL(KQ T ET LAYsp`EDNO F(I0D8C@WD F DH F(F0`D D A M H(A0I AT I(D0D8D@DHCPWD`WZ@BDD g CBJ z(I0](A CCB AZPBEL D(D0D@b 0A(A BBBG PHMPOXC`K@pBBB B(A0A8G L"z 8A0A(B BBBG <"T"L"A"T"T"L"A"~"I"O"J"K"@"T"M"B"P"D"_"B"\p[BNA H0S8P@R8F0X  AABH f8G@Q8C0a 8O@O U 8G@B H|pAGL M(M0a(A I AAE f(O0H(A FAA|BBG L(A0A8DPXR`tXBPbXN`[XCP 8A0A(B BBBK XK`\XEPlXO`IXAP0HBAA DP|  AABH \|ACI R(F0a(C D AAA M(F0Q(A F AAC D (N0N D(N0(pBAA w ABB (AIJ P CAH H4hBAA G I ]  AABK x M O C L d"BBB B(D0F8D`8 8F0A(B BBBC  8C0A(B BBBG tEW A qD80,DDh XdlpAr  4 EMD  DAF s DAH @sFAF H ABH b(F0c(C AAB`L0pFBB B(A0A8D`6 8A0A(B BBBF thKpehA`W hKpN \EtL.b{FBE B(D0D8G 8A0A(B BBBJ .h[Eb I j.PhT/LhxFEB B(A0A8D`hTpWhH`n 8A0A(B BBBD h/ti<|/iECF W AAI D DAG LDA`/i?FJB D(D0 (F BBBE v (C BBBI S (F BBBA  0j(40hkEG P AK XC`0k4t0kFCD  ABE kABx0l|FLB D(A0N8D@M8A0^ (D BBBG 8K@e8A0b (D BBBD  (A BBBF (1n6LL H IL1nHRXd1nX FBB B(A0A8G`_ 8D0A(B BBBG hKpWhA`|1xSBBB B(A0A8D`N 8A0A(B BBBJ J 8F0A(B BBBG  8D0A(B BBBE @2|T2| h2| D|2|FPA Z ABD o ABF w ABF 2x}OBD I(G0 (A ABBC ~ (C ABBJ H0m (C ABBA 8[@U8A0L8[@U8A0PP3SDD F(v0F(A Z(v0F(A OAAJH mCA\3(AFFD A(D0{ (C ABBH j (C ABBF `(C ABB$46EFD bCA,40aH@4FBB B(A0C8D@ 8C0A(B BBBA D4IJD O FBB j CBA q CBJ 4EJ AA 4d"EXH5x4FBE B(A0A8Gp 8A0A(B BBBC `5lK A |535|@FBA A(D0 (D ABBF f(D ABB0L>pNAAD o CAG ICA0>KADG c AAG PAA(>ADG L AAF $>TAHG CA0?TyDL oAAFR 4xvdPvdiskps3diskivirtblkmmcblkextfiomtip32xxDzvtmsײskdscm(bcachenvme@zvolVxDMPAExŏ6,_is} @ @u !5Nh}@@ @ @ @@@   AAe;6pk;sAr;ViIv;^:Ac|;` " " `$ `$ n K " `K " " " ` " P n P M " " " ` K K p L " K " " L | @L ` `L @ Б ` " " L P| L Є ` L @ В " " L `M g M M # " @M " " M M ` G ` " " " "  " P " " " " " M ` : P @K " " " " " " " " " " " " " " " " Arr .5AN\ht|ǜ՜'7EUcp} log_seq_numSeq@ log_typeLogType ,log_contextContext 6log_object_typeObjType G log_object_nameObjName \(log_object_idObjID q0log_object_groupObjGrp 8log_object_group_idObjGrpID @log_messageMsg  Hlog_errnoErrno  Llog_ret_codeRetCode DZdevtype_nameDevType  devtype_max_partitionsMaxParts  devtype_descriptionDescription Ա&lv_uuidLV UUIDpX lv_nameLV lv_full_nameLV` lv_pathPath_ lv_dm_pathDMPathP_ lv_parentParent^ h lv_layoutLayout ^  lv_roleRoleP]  lv_initial_image_syncInitImgSync+  lv_image_syncedImgSynced-  lv_mergingMerging-  lv_convertingConverting*  lv_allocation_policyAllocPol@ 5 lv_allocation_lockedAllocLock* H lv_fixed_minorFixMin* x lv_skip_activationSkipActP*  lv_autoactivationAutoAct * lv_when_fullWhenFull3 lv_activeActive\ K lv_active_locallyActLocal\  lv_active_remotelyActRemotepU H lv_active_exclusivelyActExclP\ p tlv_majorMaj  xlv_minorMin @lv_read_aheadRaheadN @lv_sizeLSize c@lv_metadata_sizeMSize 0 seg_count#Seg originOriginpc x&origin_uuidOrigin UUID@n @origin_sizeOSize[  lv_ancestorsAncestors? 0 lv_full_ancestorsFAncestors= p lv_descendantsDescendants`j  lv_full_descendantsFDescendants0i  raid_mismatch_countMismatches 8 raid_sync_actionSyncActionp p raid_write_behindWBehind:  raid_min_recovery_rateMinSyncp:  raid_max_recovery_rateMaxSync: @ raidintegritymodeIntegMode@  raidintegrityblocksizeIntegBlkSizeZ  integritymismatchesIntegMismatches` move_pvMove0r &move_pv_uuidMove UUIDc convert_lvConvertn 0&convert_lv_uuidConvert UUID@a pmirror_logLogo &mirror_log_uuidLog UUIDa data_lvDatapo 0&data_lv_uuidData UUID b pmetadata_lvMetao &metadata_lv_uuidMeta UUIDb pool_lvPool0p P&pool_lv_uuidPool UUIDc lv_tagsLV Tagsk Ʋlv_profileLProfilel  lv_lockargsLLockArgs0 lv_timeCTime Z Hlv_time_removedRTimePY p lv_hostHostX lv_modulesModulesp`  lv_historicalHistorical, Բ writecache_block_sizeWCacheBlkSizeW  lv_kernel_majorKMaj  lv_kernel_minorKMin 8@lv_kernel_read_aheadKRaheadW xlv_permissionsLPerms  lv_suspendedSuspended@3  lv_live_tableLiveTable3  lv_inactive_tableInactiveTable2  lv_device_openDevOpen2 3data_percentData% snap_percentSnap%p Xmetadata_percentMeta% copy_percentCpy%Sync sync_percentCpy%Sync  cache_total_blocksCacheTotalBlockspG M cache_used_blocksCacheUsedBlocks G a cache_dirty_blocksCacheDirtyBlocksF t cache_read_hitsCacheReadHitsF  cache_read_missesCacheReadMisses0F  cache_write_hitsCacheWriteHitsE  cache_write_missesCacheWriteMissesE kernel_cache_settingsKCacheSettingsU (kernel_cache_policyKCachePolicy ҳ kernel_metadata_formatKMFmt0E lv_health_statusHealth  kernel_discardsKDiscardsT  lv_check_neededCheckNeeded1  lv_merge_failedMergeFailed1  lv_snapshot_invalidSnapInvalidp1 0vdo_operating_modeVDOOperatingModePT Pvdo_compression_stateVDOCompressionStateS  vdo_index_stateVDOIndexStateS  vdo_used_sizeVDOUsedSize O  vdo_saving_percentVDOSaving%  writecache_total_blocksWCacheTotalBlocksD  writecache_free_blocksWCacheFreeBlocksD 8 writecache_writeback_blocksWCacheWritebackBlocks@D @ writecache_errorWCacheErrorsC V lv_attrAttrR hpv_fmtFmt@l o&pv_uuidPV UUIDP @dev_sizeDevSize  pv_namePV pv_majorMaj0 pv_minorMin @ pv_mda_freePMdaFree` @ pv_mda_sizePMdaSize  pv_ext_vsnPExtVsn R @ pe_start1st PE0 @@@pv_sizePSize δ@@pv_freePFree x@@pv_usedUsedp @pv_attrAttrQ h@ pv_allocatableAllocatable) @ pv_exportedExported) @ pv_missingMissing) 8@ pv_pe_countPE@ h@ pv_pe_alloc_countAlloc@ @pv_tagsPV Tagsk Ʋ@ pv_mda_count#PMda @ pv_mda_used_count#PMdaUse @@pv_ba_startBA Start0 @@pv_ba_sizeBA Size0 x@ pv_in_usePInUse1 @ pv_duplicateDuplicate, @pv_device_idDeviceID@Q @ pv_device_id_typeDeviceIDTypeP vg_fmtFmtk oh&vg_uuidVG UUIDP vg_nameVG vg_attrAttrO h vg_permissionsVPerms  vg_extendableExtendableP, * vg_exportedExported, C vg_autoactivationAutoAct`)  vg_partialPartialP+ Z vg_allocation_policyAllocPol p vg_clusteredClustered+  vg_sharedShared+ @vg_sizeVSize` @vg_freeVFree @vg_sysidSYS ID@ p vg_systemidSystem ID@ pvg_lock_typeLockType`  vg_lock_argsVLockArgs @vg_extent_sizeExt  vg_extent_count#Ext@ h vg_free_countFree@ ( max_lvMaxLV@ X max_pvMaxPV@  pv_count#PV@  vg_missing_pv_count#PV Missing  lv_count#LVP ȵ snap_count#SN ׵ (vg_seqnoSeq@ vg_tagsVG Tagsk Ʋvg_profileVProfile0m 8 vg_mda_count#VMda h vg_mda_used_count#VMdaUse0 @ vg_mda_freeVMdaFree@ @ vg_mda_sizeVMdaSize  vg_mda_copies#VMdaCpsK 8segtypeType@K  stripes#Str0 p data_stripes#DStr @reshape_lenRSizePM  reshape_len_leRSizeJ  data_copies#Cpy9  data_offsetDOffJ 8 new_data_offsetNOffJ ` parity_chunks#Par @8stripe_sizeStripe @region_sizeRegion @chunk_sizeChunk` X thin_count#ThinsG discardsDiscardsm  cache_metadata_formatCMFmt C  cache_modeCacheModep 0 zeroZero0 X transaction_idTransIdB  thin_idThId9 @seg_startStart  seg_start_peStart P@seg_sizeSSize @seg_size_peSSize seg_tagsSeg Tagsk Ʋ seg_pe_rangesPE RangesB  seg_le_rangesLE RangesB hseg_metadata_le_rangesMetadata LE RangesA devicesDevices0A  metadata_devicesMetadata Devs@ @seg_monitorMonitor@@  cache_policyCachePolicy4  cache_settingsCacheSettingsP  vdo_compressionVDOCompression/  vdo_deduplicationVDODeduplication@/ @ vdo_use_metadata_hintsVDOMetadataHints. h vdo_minimum_io_sizeVDOMinimumIOSizeL @vdo_block_map_cache_sizeVDOBlockMapCacheSizePN  vdo_block_map_era_lengthVDOBlockMapEraLength09  vdo_use_sparse_indexVDOSparseIndex@. @vdo_index_memory_sizeVDOIndexMemorySizep @ vdo_slab_sizeVDOSlabSize`q 0 vdo_ack_threadsVDOAckThreads8 X vdo_bio_threadsVDOBioThreadsP8  vdo_bio_rotationVDOBioRotation7 2 vdo_cpu_threadsVDOCPUThreadsp7  vdo_hash_zone_threadsVDOHashZoneThreads7  vdo_logical_threadsVDOLogicalThreads6  vdo_physical_threadsVDOPhysicalThreads 6 8 vdo_max_discardVDOMaxDiscard5 hvdo_write_policyVDOWritePolicy4 @ vdo_header_sizeVDOHeaderSize0L  pvseg_startStart@  pvseg_sizeSSize@ Hfs AA@ |     @˶۶ ߶۶ &  $ AA++k AA EPKDEApKDEA`KD`EAPKD@EA@KD EA0KDEA KDEAKDEAKDEAJDEAJD`EAJD@EAJD EAJDEAJDEAJDEAJDEApJDEA`JD`EAPJD@EA@JD EA0JDEA JDEAJDEAJDEAIDEAID`EAID@EAID EAIDEAID EAID EAID EApID EA`ID` EAPID EA@ID EA0ID EA ID` EAID EAID EAHD EAHD EAHD EAHD` EAHD0 EAHD EAHD EAHD EApHD` EA`HD EAPHD EA@HD EA0HD EA HD EAHD EAHD` EAGD@ EAGD EAGD EAGDEAGDEAGDEAGDEAGD`EApGD@EA`GD EAPGDEA@GDEA0GDEA GDEAGD`EAGD@EAFDEAFDIAFDIAFDEAFDEAFDEAFDEAFDpEAAXAWAAA;' :' Aΰ6C{CCYYGGFFEEDD[[ZZ        ~~vvuuttø͸Ըظ߸ "D'P0t7tt; jJBGJM PU[`c4k4o@x@|LLXXdpp||ǹ˹ԹعsdUide@_mdhloopramdiskdevice-mappermdpdasddac960nbdidaԱccissubdataraiddrbdغemcpowerpower2i2o_block iseries/vdgnbd)aoe>xvdPvdiskps3diskivirtblkmmcblkextfiomtip32xxDzvtmsײskdscm(bcachenvme@zvolVxDMPA\Z" 7 n @GEthin-pool@@Ethin  "! p`   @D _  St8Uv 8h8\v8&888gv 88 8E 8x 8lv8 8vv 8g8p 88|v8v8$v8) selectedSelected helpHelp ?Help helpHelp ?Help#AAL0o ` Ъ  @0 0z@xByBFpPЙЙ'`$`&"`#`!+p,p (`%` PP`  p)*P2 - 3.mpl9 T i z         @ `CpCo`` gD  P, oH*ooo*ooH(oeDp 0@P`p   0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p          0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p TGPf G@OJ82pDpD pD pD0pD0pD@pD@pD0P %?I70-,&@  %PDF,&@ ccD=q cpMDH= =eD =c >7 >ð  B > u$? V c BduD8?mecDp?dcD@d @cD A d XA-"d A#d"H$F-dUDBJd \|tDC; mrFDfd"B$(Fvd FPICc d FHJd  FKq"d Md"dbDS  $d $PFd A$F d F!ZD*D xT"d 0U#dDU$eYDX%e 4e FX&Ie Y'`e Fp[(tepDx])e0D^*eKDh_+e3D0`,e-Dc- d2D@d.e$Pf/ehDg0eKDF1fID0k27fUDpk3CfUD@l4nDn5RfF(q6jf"@MDq7yfUDt8fiDfu9xwiDw:0{UDX{;fD{<|jD|=f qDD8}f>fDx}? D(~@ pD`ADBADxCgpjDDgpDEЃYDF0g F8GHgcDHWg cDIjg geDJg FKgpcD@LgpDMgFNgFOgFpPhF8QhFR7h?FȍSLhFFTfhF8U{hFhVhFWhFXhF@Yh@F`ZhF[hF\hF]iF`^%i F_6iF` FaFiDbYi jiDpcvi Ddi (DPe_d 8fibDpgi 8h2 @ `i;e" Fji Pki li 8mi hnd  oð pi H qi"cD`r`"xFsr"xFteD xui  `v. 8wi  pxj yj zjd H{'j? |w }n  `~-j6Dh ð @Aj FH  FRj"@ Fcj"@ Fvj uj {jj juDjHj Fj2Dj*DFj*DFj k k)k4Dx@k @ Lk \k Frk9DP`DDkKD8k KWDkxkFk lcDl!l wpD8lHYD@QlFxbl]DFnlDFlDl|D l}Dl|DXl A Fl l^Dmm -mdDAmhQm hmdD~mm"`Dm"mdD@m"BcDxm"BDm nlDn(n >nlDSn`dn |nlDnn"lDn"mlDn nFn o"mF@o"B F2o CoDSop`o \|uDqo @uDxmeVDoxDooDo Fho3Do9DoVDoYDo 6 pYD0&p@ 5p Ep fp"B Vp"BaDrp"BYDhp cDpcD@[sD8w  p pYDhp 09Dp p$p h $9DqdKD87qKD  dYD SqYD pqdF qFq"D>D q>Dd?D`q?DqcDq qlD  r"B|D(r"B|D rD 2rD ErD (j h oED! `r@ H# orED`& 8-@ r"D F r Fr Fr F F H F r rD' rsD( r ADP* _ + #n + h 8- l A `- r rlD- g$D- n'D. r 8. slD. s )s{D`/ 8s FseDA Ss AeDA as AeD@B ws s B s 8C C s D D s s XE s E F s pF F s s HG s G G s PH H t t I 7>JQJQZaZaiuiu{x{xZZfZfZ,'l'lddvviiVV^^WWiixxAK0v0~ p z z Py ~ `~ 0y y x @ 0  Ђ P Њ P @ У @  ` ж h!~=TpEpE@ 0`00xB oNBB!WBxBbbBB@ojBuB&!sBBSBB&(@CTBTB@BX&`  B@@ C`'CxB0oC'C?CȊ ЦKCSC@&iCpC&C @@@whh@ЮCC@C@&` !Cȋ&C0C  3H]Cx'C*d[ C CCЋdP.p!D D"`:DCDB'smBRVB' BR`D&lD8yD`@;D$HD'DHD؎&TDWD0]DX@aDDbD zEE~"E,Eph5ELEUEkE(&`!oEvE&EP@xFxxxxyyxy<#y(yMyCYy,yD8y@yLy@EXy`yjyDuyYy|yFxy Fy Fy F[y F@y @yFyyyp=yzzC z4z=z@Kz`Uz@bzkzz AzzzAzzz0Bzz6{PB{ {zBzzzB{{5{0C{ {0{0IA{ {{E{{L{0FY{b{w{@F{{{F{{{0G{{{ A{|!F||" H"|*|#G4|:|$GG|P|a|%Ho|y||&PJ|||'J|||(J|||)`K }P}*K!}/}:}+KI}T}a},@Lr}|}}-L}}}.PM}p}/N}Ё}0O}~1E\|EEEEEFF)F6FJFZFpFFFFFF FF G G 5GFG [GlG GGGGGؐG H H4H(DHbHHHHHHHII-I>IWIPxlIIII8 I`!"ؒ#(I$ JH%x&ȓ$J'>J(TJ)mJ@*JJ+J`,-.Hx/J0ȕ1@2p3ȖJ4KK53K6(IK7`KsK8KK9KK:KX;K<LL=.L?L>ZL?qL@L8A`BLCLLDLLELMF%M7MGNMaMHtMMIMJMKMMLMMMNNN3NCNOWNgNP}NNQNNRNNSNOTO#OU8OIOV^OoOWOOXOOYOOZO8[`P\PP]0P?P^[PsP_PP`PPaPPbPPcQ!Qd6QGQeZQiQfQQgQQhQQiQQjRRk!R-Rl>RKRm^RmRnRRoRRpRRqRRrS'Ss@SUStlSSuSSvSSwTTx*T=TySTeTz{TT{TT|TT}TT~U%U;UMU^UkUUUUUUUUV V-V?VMVbVsVVVVVVVV W&W;WOW_WuWWWWWWWWXX(X9XNX_XoX{XXXXXXXXAXX7LYswYwYmY*Ya8Y o@Y 2oLY \YhY KsY |Y eYKYeY"eYLeYlY6Y)YJYeYAYAY ZZ&Z4ZCZQZ`ZnZZZZZZZZ[ &[7[ M[b[ y[[ [[ [[[[\\.\F\\\q\\\\\\\]]&]:]H]U]i]|]]]]]]] ^^/^A^\^v^^^ ^^!^^"__#A(_-ξ3_=_E_X_Ți_t_ }__ h__ ______8_ _#p_ ` ` `p'` =`@Q` \`(e`|```ȩ``````` a%a2a =aZaja 0xaaaaa`aaaa8fb bb-*bCbRb._bqb8bbhbbbb (b bc!c(e"'c Ⱥ1c#AcOc$\cgc%xchc&c0Ⱦc'cc(mdXc)c@c*cd+d(*d,:dhHd-ad0xd.dd/ddd0d e1e-e29eCe3Seae4mewe5ee6ee7ee8exe9e e:f$ f;f#f<0f;fq=Tfff>pfxf?f@f@ffAffBffCggD,giE>g@MgFWgqG_gqgHggIg0gJg`gKggLggMhhNh'hO5hAhPOh[hmhQhPhRhhSh@hThhUh0hVi 0iW)iynXAiXlYLiSiZei)ui[ii\i i]ii^i g_jj`&j'9jaKj[jbvjjcj jdj jejjfjXqg k khk'ki6k/CkjOk (Ykkjk,ohlykkmk@knkkokkkpk`lqlPlr%l.ls?lNlt]ljlu{llvllwllxlXlymmz)-!m{2mP6q|Am+ Nm}Zmp dm~qm |mm mmm@mmdum"HmnXnn,n8nBnMnVnfntnnnnxnn!nnnnHn ooo$o0o `:oJoLtXobooo&oo ooX!oo!op",pBp8"Vpep`"rpp"qp`#Zqp*$pppppppqq$q 2qEq+Vqjq*|qqqqqqqr(r2ro:r(KraXr&crakr0qrAr1rAr2rbr2rnr3rbsdscs4)sc7s7CscMs7UsCas 8ksCzs8sds9ses@:sEsvhfsp:sfmd;cfs'fhss.nH`8<)hHt<t?ξti't=0ti=t=HtiXtfti)- >rtI6- AtltAtltAtltAxltItlt us`LuK#uM2uM?ujIuMQukgu(N{uKuOumuO}fmuPuMu pWrnuXunuYvnvY"vn.v8voDvYNvOWv]^vpuv ^vpv^vPv8_vPvvqv `vrw%` wrwHa$wR.w6wRF-aEws\w(bfsqwe|wswlwswwSwlwtwnfTwowwpwuwrwuws xUx#xv]dXuvV/x=xVMxu[xWnx`xxxx{xxx{xygd |xZx|x-ξPP`A$H$H%H%H %H %H0%H0%H@%H@%HAa `report(H (H8&H8&Hp&Hp&H`^A)H)H0)H0)H@)H@)HP)HP)H`)H`)HALVM-/sys//dev/mapperJHJH55 ZD,/r/EHaH;fAwĻ BB  @H x`  8 ha  0 ` A 3$(26@DNKR@\fgisx}q@J\fq 3$(26@DNKR@\gmNHNHGA$3a1@ GA$3p1113$GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign GA$3p1113ЕGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign GA*FORTIFY&GA+GLIBCXX_ASSERTIONS GA*FORTIFYЕGA+GLIBCXX_ASSERTIONSliblvm2cmd.so.2.03-2.03.14-15.el8_10.3.x86_64.debug/$R7zXZִF!t/]]?Eh=ڊ2N gC+ip ٔ#dR~xJ&HV];E~vMqq#&=u3KN 0" ל9im(_?|* zYyf$r,!ܼ1YM)iOcA32F3iSc%jupziоjpݞ+!' C`1CD:}uoa:F«iP+]<,57!'OD06x"6, ^PXV80?/\wn |4r 6UrYR.b3am刘LfpA2AfbJd{ٗH g ;_3w_ iP?a~ b a` cx{ҥ꾪մKUdM;{EF']{Uz|^jcT.ߴTC Aք\m0c]rP@J*ٰX:.ZX'/m98z52$^7qaw0=Lm\8\$L4$EOa̜3+i]ө@sHO'_$} gzp̣c>@}DǬb@w"#q(`fyjS.?'O8#eB?]@Τ|k(nM?ۻյN7mx^Z.dG;%Fhvv\;E|qr(0v C{)"!<87Mh$._(A U{vXEÝ.+@ϻOj<А|ӂrXc*!+*ЛyMj3wWCO毂],bVv`i}JDFXpM%Mpź;ٍT@v`1 Ы&j8X oPYkU c5@Z9`675cgV@`l=yw#Gv.~e2G3FzY=!qO<ӪkNoVt7zXԒ_j;1<uѯ'iOlo}]#d1 ƸFj&v9f(T+:6gj2 L'[ keAr}U@K~\ r6+]Eԫ}Hj3[bSlH}3~a<qblLKb>*63uZR1]?.mȣ,LnM4aj>o%_|ΚmxR4-R.28=VRnݙ!y #L%׵hA^)-$twAph&p`(ߌH9ӈlHTxƳ$PQ;tRp-]Zo-s v*|!WiM.V|$X6()JK=B9 lU*G#ʤ1T]iM-jԨ;}2Omj:kwdSuB􃑝Ï;,o.eE( @׉.e~0Ias6;J(_ a٪ۮ^၊TQ%ųP4SQ-wž+i~GՒ0itNMRXIA D"t kq#,uɆ,;y~': yr{^^`nt 3)$<8N(3)^}oo Vq[ `~X ;sHiv :6t$3F:usr">LRA[D5HbX"$+}ONZsf 0O'$5cb&ǰ|.|ٓ=p Ґlxe#qCN\*RM+9KMr\ sG7͒zt'T(əS(^uy B>ZFQJ}F* Z7kZT|F8I@ʲY'O5'ꏒ@a42=^#恎,ɯ Vr>^d Nk'0 Ig4\ c@&՚%@ fkJ:9줧(Wv<ߕVŵh225KXHG!_Jѥ4x,<%TaS34.hJw.|;q71137$mw<(X"rtӞ–\KhN_&50L/bջ[Q[,#.li& z ʱ&[Pr4f H.q~sG6;~'Cx|?$H;4Mɬd 6EHnvZ_jPk.[+﨟H7_nlvG):#f~?`\mc,X@%liyf8"- 7;ooi@L, ج*DfDsUUUkVM7-B,RLrH' p&4RowQ)JzR@Y:ȕxXD@,IIbL>FOWOxg3MPI$hgzx8@Wԯ[QenEF{"k:Ӏ4'~/f(qHՉE4pc_0Hr@9e2n=#T4?UBY$'@D$pr[;!ͷ^ ^\AM|p ~ ֻZ!h,vX(ds0i2k/PU1hJ(D H"V&jr^GŷYMW>vnpfY3zeͤB+azklLL٨[zM,H5Ual9?X>*?I`mHHMF wjͅb狐J?*+q^eP7-L,7.|"NJ%Q^(E7-K=ގ@2]27'MFX=@}!M"^"^yoAÙT(YSb s01Zq~챴*H"d2>dBt/YW1{,)<\)zý[\BE/]ɇP^kkkkǒF{Kp.]E,fxy,n }-kzFQ-&"5w>h e6f-ZD>[Jˬv塺S72?E{b#!q#_)$I٩`&xczSw3آ8ڄ{ :D&[zDE_;k~(Ml&}u$:ӈ~3+ LskUp^fH78r4@'ďu[,"fThqȋr(1!7swׯYl~a|0`Uz_&O?=qFA H+BDݹKҰ ю=zrϯMiOK rk@D'G)[sSGbsH[#L7nmϫ՗<$9^Q@14LJIw*QTvxيW  LNa!J<a@Nx5Gmد?zA:t]Y| \~]T&c/o< 0ĄFNצ(wR.>SLV0PK3SvSPMSD Uvix*?X|g}5"L0mTBk@:x5\?uN*(>wrRGX~%TZiD/`91YqЧuV>vj+T&De *Wy{+gGO/r8Ɏb 3q%ٻY>BEkm rS:D  8ZkDBk/L. G-'z w`A4+nE=R@xBrTCQHZLz6k S}j  7o^GҖ/Id~*Q-T {n*,6~fJ.cL!}BE^m 3ް~|Ѧʹ5:Y/t󗺁ZS51VqŌxpUOjw eIK#6Tr\70S|o)I<QI|X8STJ1:Q)rڵȭڅόzo&;)!B^C}sVt/e%ۧCd=nBvTNK/U Hj6{FO <_֬sVž}BUaOˣ⏳ V֒TЧj`x}QEG mo<Z Z Csy9)|5L[][ZY u2x̴9 Ja6BX`8>vFWX¸1I[Da&Zz#ԑ&;D]WE9۬t@hQVi\i9:$E!d#mŎ Fc) To#x^B&rJe!mfΥC9'D'Z\>FPa}.ѫdLUaDRkjZ')@af B<Q~FC$mP>m$0R ɧyfWfsPԬ=PMcT¥>":fkc?=Db5UNl,j9MDH;5J?T+cocPHsrv@Y GeѣXRf$0sB H% d䷮CM sz)QF[ՑgbRw3^X/$;(@2tanK5rBT_zh˽S?a?p:UϽ dA˟`~j[xϨTƿ m2od~韎E[qۂ>XA87z.n栀 a<@F@ĥTWC=̌Yk{#ga RvX|yt9OAɩ,N0__p?v9$h>ZS*0@oN5C 7n1,(J]1ͽ-ӪydpC<]ji`S$kۼ/ TPEH.? ƴfB:_ůLI]],RcW\A'O3wmuW,8VZyh*,Q Z+Szt$q96;.s 5lt 2,-W\q:[Bt5'N@VzLDTӖb l곱 |ʉ)+ԕ?_jp++]M*IRB@p$.z av\В6ĬSz?#C oʧvƆǛvvD"G"AOrOZNvbmE౥V cqDjwoc\]ٔL lpNZN%i? 4@l {IE5:"n@"/B\6?X/>^ eVtޤES3N#0n;lrat ,ȝxr1?쒰B:+> ;K+3PC˵:Fw J%(5ZI9<B "+mP\-ks!wE|更JqȚK;XG:5W }8x퀓@aMzԤ޽.'ۄsQ@O-y9L2dD cgg QM8Kgr|sCr>g$.[ vHD{fL$&(mlu~_pG}n#PL)|N.;Цϩ'Ƙ%,)%/Nό*d Q-b{9{]$dҞgSXsҀl"I[e )6٪n1|rVK Y {DDY#byo2smAo$F]Zp;d-W-A81 Wc:P /rLo@Rcۆ2560S֩ w ߨw5)q% /Vy3.h1͍0:oV!(iy!؍?'<('Y8&cn@"A)(T[+콺lƚgj,)Ӈ|2&"^U,USb$Ps1 l~ !Y%{O(z@?8HO%87I>"OUJ [ikoӾ;``ڄ7"h…{ِRǯ1§ww G{֐HҾM8Ph-Rr}vPR c 5~536?DeWxY\/16K=?#GŶ^Y;z}‘Tm (>(ro WRci:Fa4;ސDUk+01 ڶ*}]+'D!Wk煩TG!gzJYRskӐ- A̓W>,^ gγ>VP؋pWw8{L Wj-EI<va6 Ih Z@h"WؗG_GbcaAg' 743~2O}/n6ַu_HSV"˨wIrWzа',]S#HO 1 0 -!; ;ix +o _`R b޷vfPMe~hէJ5ݑM?uJޢ?;k>B6}ՃEDԗDi Gl̈́b\.;OCAdzN[v ^4f^p=!_T0V8H>hyKf ۝(.e+U͖K,蝣ٿ|&u)D0/AA<[k kc0ҎR5¬v1R.=σݖYV(r,6a/?1-HQ¯39U)1ݖ]}wM)@ž.F  5ZX fdۛ؜΋YL[π7Tk1/6<̎ЎpjF-o|o@07YFul`ՋKrI n"NF>;5,:ȐIon 1;po̼^)|oٚd!:@C5DtDRMmz=Ne`=R."CxL1.\|}+ڕWQsWw(iz_0.,i޺2OEmN)\ILI {;:)V+gLea`[jWoBz~Cэ/G*n\S1ki|D@85GY2ˑ VW4P "ifK6 J{FK5 4-<̷J^|KnucR/z⚤Z97w/?0e 1#Oџ1t* )xItL$V"Pլb#"-Jh%KZmXm1k{sQ aPn,`bl\0ݱЛL>ƻb-X r:'h{; ָMݾ5.^1ĥjLu)wG5G4@͟{+z43W9fg7˶+| Dj׫W@h*}H3%q|'Sͧv7$(n gZจM4' %}OHQY Ya-f}wR?K.OƎ:Y&%M6>p`x ]oqufl4Tz-Ay{l}(ȉywnq6 [NbmoխIH(X*!cڏsp>H8FU/K&CrR4%HVP%R9ղu^vGa-͔bꪇ-ˌ*ZNh*lF,0햨@4lSEzH{.U'=eFQYt`-?E3ƒպ?ƛuǂMehijQwх|i B5}/ǟ9bYIz~εT$ UV@BqmMdˋ)E"ieflBDx!=BP ]54i~V ohAxJMpuEYo:A**=!^ d >u  DvEo6 d>~(5if6bK8{h#Z+O*nCZ=!H PMi!4=$ʅ #qiUdyVUfrZ=s:%o.](#7`ʍA{CH i3@*,&FtUto*al-[K`-"TV>J;#Mn|P`:2PҘ$}ɀ`#r^KH-ɰ#qm{H(^4 7D ]K $UZi#.xTODG &e1J b!U.ޒj:0,~>fnί=CH ;N~:o숄7lOp<p}jټ; M/-uâTOجd9!(>Э1r@[4Rh:Q[9n8ٌk}:镒dGJ"Pm@wuxPhWLoTץEz dB ;xHQ/7a0Gd ]Q<[4!|ڑK~T灈535{ Lu޹J+u@&pU=[^cY/Y /'Y^K^O5A>V\Ng֝O Yةr&'"lABmL׊dP-[voP 㑒sH^OEffיJ)VzPSzZ"e1;cuP|2 tc v=[0qVEʂ@d`˦^8&\=Џo.ݑx[.leT_7.-|^t)lXd VU,T2A]>#1`op /)ի0!hQ.#u:2y%Z0/ˬ+"K %0Oo~LsgX|)|：NO#K,Lz8+%ZN\\=k KpQ;PbQvYp%;d*#a8Эr {D8 C9:3xj#g'lll$8ŴªD>'a* DBT>W{ݔC6VU,*MbpREZ$܂]Dq&삔g#ᰤer}%bTeu(847(b҂VSj*+`XNb n1S;j۪[^ :ac_7$c£ddV}g_ {Gt -(W?7>3W(&`Y-j9?xvs\8{` )QnH/'\b RQYD*F8\ }}Wnˋ~Njb3ġϘ2PW`TDJ\dy2ٗ/N/N%d Vs!Yshy(;WQX 2*Zv uȀɎu ]#!-kZpɅiDbﵤV @ -/B_L'Z8eC;֧a5HG饸M5'@6Xuf&٬;l댫Z7?EAAR0}a?,=P #f/?Qؖ)m@Fz~ M(F!FrH` >"3? 2s+U|ˋo- ' şd~CJ٥#tA1Nwא9f݆x<S}%C~|]lzĔ6Ps`exBfYBOz h?IOFnGi7y(&TuL~h-IؒW]XƔUHzVEЧ2G N2݉1vP)*wWjc}mpMWehTkrqCB`t5"i˓NjHNpb&@Ѽrd s< a@}2} P"1ב>"N`޸& ۺ`Z E)~@aR+vhEFy`1k0_VǠGrE* |<|tu#;E 5J 7%$.fۑx2,.(ܢ/QՋX_E Ke4m(?nY<+G,fmnЭ{r/om#9brYg햲7NhըٷVddwΔl,xcv!& Ѳ4 |&6"JGd߹xع7bvh-:*H|y ̼ 95h% nU=R󟹲a%>XX _m{0 Tp 䶄~te 8Ьc\|wZJǡ/08vi-8S訜\ln)̚>aQ8kk I$M}~} 7͇<4<) ̌Pg[o }dS`({69 Y6l(1XFkLi!)`DZRN_ uɴ5V \c:6o@@|mrՁt*O(ma$7Lȿqu U|jJMe}V'fio2`93:c/eS?.6*cv<ԢLфZBۖJK&z%^G7W}1nQgv rvC?ld ᪟];'-8MO\~PDNοHc\cuAl;o#3b5~U>:J-cC:!/&k5u_H./d:G#㤬q6D<VWލ Tg!y˿oVS2DDB͞*O>TpSBӃ3*=JȢYcrQ $M_LLAG8:?z-Σ53ܯ)kbti Re`ʅPXU`B$vc =hU,~G7=“@4lih޸ & +ZőkD'Ck*-RŌ'Զb&U~H5I8#]xQ,v`cPDc :VI;j26 ݣ1|7d?HCsIVČUSFm@2=><2tVМ%Vp6҈Y4oq^)1]Ō.3Δ^5}P{VNf4f&;pR܆#sc8S -iz6:^r^qɋ~ PS\CCB$Q ^I/qbF+_1lے aCxOuD7]ʣ`R/SeBݍeI YiiLWXd0/?8Qʶxth(I{n +6m/N[U0c9\|/oZHL0cP䑄 ^:]փEJKMZ`N@Bx8 J˸[T. *PtT6D"Ԙ"6=g HxV ǚ]kDeX$AWQ lȐz(\,aqĘ@/kuãK}ѝM=I6 ]wtv d8SfVTdf*)v*&Te:6fQ=v mTG,e.{}ZFĜȣ緉4W *g͙*ȹRY/^W gs}]w",/x,"jɅ3* XAhK5~^erLHq;%ƶӟ[hDQ7A 4swb3KSuЀڮ-?`tUn+/"joB*W*wxYGݝ|șZ[IF.x%L\KQN d)i`bKǧ: y3F~گ_׾1G[,θw(]!o/fYL*(cE 8arcǠXZz .?xpK-M_0M*Rf֮()vjSv@\Bs$\ 'dta!2"x':ڬ`/wR{7S#/],@9ٵ5I5JzkG@Xy+Ͻ@=ٻ%2(kAEy pbg:NL_D+A`-=p+͵| t{QO?Z [pEީ0~4iéĮw=!L>V]—8Ow|o)}<3"O#W[0ag0 N6۷@()tJZ{zPg.۫U^lyzy=}e{017d6]#<|JuS / B֡*E[{\. u!QRqy؁i[%|) d/VVPM}it>ͱ_Wԕf3AEN Iͥ^FTo_9|BX'ُ=RR ܨ;ʶT<2VZJN)zl&ësS\MMc}*3FEhO=1CvBm2*u]%HkxGy5:$ vxv#ϑtƠV4ȶ.+L[a3{)WDz%&hVgæa<>=& :^qG3ixF z5 9Q,MN ܈ºs6ޜq񘴹잜P$?"4sC ݧ#tR8xBsa6Auҳ|-@AϭqIʪ;Wxn>i-raf3<#o]Iq9socy3JNB8CSW+B2ob`F/s?̆U:~:/|J_+]d$[pS}0Q@Ryn֢=MOK .ejL}Tc(&Z>$g<*X7ӫfEg;dNu2st]"3}. c?"ZRP pY_n#ȊiAz^Pd@=8@-c7Ww?CuD2c,p'Q h ^kF:VRJ@"!J00/kw ) sU{_/F։Kx# k6nP"](XJA^I'J*LU3ָ3 YK\!WDnJh:6euL{z  ;7ġ ;gG9ҘK{xCq!>,% LƂF s t+CٮVqn~Y[Ղ A〕"@ZĞjTʝT܊ ]Y'Fd/_|I@'@ Ulb ' }.fA9&Xh y? A۝2g0quźi޽2<9Z*50a6shf}vJ0!P胩[grm9Ű_iXw8TxG~"A! ]xI쀬@hqJ/_{"=&,S|r G,S?36~c\ɧ(=5DC1+s bC,EUoͫ#Ye= Ʀd5kX΍jw y EC<;%i51˒LpG;8~LZcD5]Yz&gӑ̥qN KƯ|TGN1RɗUv<\ 09Fy~ ^TpGAƴʀ!jGw9 `u[L M c싟# e/ f/>~λkQ\zNl Pz3]bv=[)C^E2]R^OR6i*VRo|)GI#Cü" >!nN~&]Gz4EzJ(R,`WtaǕqt:6 nxOJ|7dnS^ )+GhaLkY$ʽs/] Nvh"g40C Sv)컌HWY C=0[UP[`lZϿGz6*ECR5uUP "- 2n5gq=9ߞЍ"&C;.w=qX!L$RƲgEMԸLΌ)HȤU|͊Q/Nd8o 'ݚJReϲTݱ}?el[9,F½CJS ͠X'M0۷l2!*On> س)\ը5#rC#ܢ{nHf͆`j+أ$A uh`7<,sؐwyY !L4^XgFɔLuNGB*,_ y"As#;yxdD_bt@m@to ;T2l\, C͑_/BAl&XS*­EkV`스QPXk S`d?|e hcj^,VBfܰۙa:(/#tOmE("G_g ڢlBB>O= $* S =h 5ۇwF-˻>5->`( ¤0$BVɝ-b|}Oh}ʠ/,v]*V{-o.Uqh?MMg.OOUKq!+*16lfp4d+O7#n?Js6Sow3zly w[={kDY?j~fߙ3;įچ- #o3eKW{'c@ +"kȅݣ+z'KmC|%lm[%qj%pE)a|_5zg7t)KXQö)85L:{'OIlAv~koϻ!k,{/Dm"E= fqs`h@#IDa#j?nȞ!%m_K+)w>j֋f3axy햶nN[s!{(?{⭓R[}+Z8QAA=rB3cݳo͍F)Z)Ng H>mf8>Hg/Nk&-^;aw\%C,y!H.bCMnA& d|XyJev~.f嶪\)3)KPx5yXT⽒ ](!OqWMӓi4ݢDg: K-Efr~N ]ZoM(/RH-X&%)U`*QM2ZPON󲊺dshpw__=o+ vrr.BNj5DžtR̈́,L<ϵj^@$bDM/;ߧovw[٫AtPkf'܆!鉸<ߦYm3:H11(W0MYjxiݭQ({kQ4WEZ1>ZLY[Ȍ|YU3hD+P g Gz!|]ܝo4^̳w SFdaZ -Ad9Q9mheLO+{8?>~8WWP-_}r^D/n!pI5 " N TG["@ShwXKrt;5^м\qw_EE@=zk҃wJFi"U$&#.:.0pYdSO<Ȅ>EP>AB gz@:$m߯wsR|w=ƽEbD!,mNEtMIQ6u=cn'] .ᯤ-:2֋ˮI] @gL۠CFJM)ٵH%ݸLpUd}A@["m¤?3epQ >DsM`ɀJŴ dо:|:vP(ch;asH \iFB"`G !iskSڸ}IzsPKTtgm_:+ȥ|2"8z Gd1R9/,vDgא(=ElJ N(WJ8)=pyTZ"$(QỔBRoH& 1*j: aM1ׂ2T<0MPP1# | 2J] ̢՚7,^jBS渲c %.*a$U>y^xz2s;~|uPlwnmE}Fg:xB%{iiʨ¿pD?_ZCsnǓzCfZjt!9kB 5%1s:LPA=\f/Fn]F˔IMU## ?LI.j&Oxg\\-d[tV`Dſ8Q]_ʚ߃QIt)6߰.x(c5̄&:VFFIlEݼ??+,a*p~3z:*j R&v:طKB&\!N]K ˧lF=x|F˸h&InkE\ꎍ9]R{ej*NƁWq6;8O3/7U5G$vmOڦFz;$kX5)iθXwڧĶ8I6ЯR#9[,vu^p6HuRͿ[hy-W7ܺעyGgIUUE8G$VXqNPq%iǕl[WnG6U.ժ1-o >6tvʺCDT$JۧpvLO3ER+&+κ!жS#,L7cna+Œvkk- Ue zр蓝AHpv/q];L=-Pcݙr)І^Ãڨ3Ţf`WE<Φ2& L-U2Afx`-'uk(?Ї2SxY/>L|/Օq_^fܓ 0B+)p!a '|ÈUR]N?!'d*B%3^wQ;u8ܫyL,ᬂ"Q)-B>4A,3oFɁ8͘+տ?nz-031̋n^Bke([Ś)6o%(gq/I`]&saPTǂ`κlraKV_AR%cC#);]*lK R!r,ƆL s !aRg\02߆q9}NצXQ:=$)ю*}vo]d~֝Y9w5pӯ>%uƞj~?A"*&n>wֹ珼;kʔ)8#,T!_g-@;W?)g,뛁:\%fг\]oGCgjX| +Ugj06)i\}%bjNN8N)*ߥA!-,vqf ɌTYQ 2 J^"!I":wy;z,bTU;n0bCE-jCQzzm=2oPS#49k s@ZX 9ZĖT7a( AC'u; Lv$%Hb"x vځ}J11*Sm':&5Y%+[-BCk c@b:˅6% `p|_Hq13~C 5.֠#|(Y +ٚgCҠϑefBm4Tz+XBKj"k(ӛ2E=` ?(@c:wwvixWXHpĿDEJޞ3JX BAXMګ;o/LTUG"Z7M>)76\VNAkl%'ctd߮͝( !M }0*߀6$$[ia78naʰBR>riDۜDk{lҲ@XL͍e4zd Ɇ>sZq|QԣK-\N)w0cPw s89_lb˰ն K!v_koG>V>ӋR+?V&}r׺8%qAz0+}F&݃ѽ -M$:ߧ팜 7+Ob!Ɍ0<.V ]' Զposy_kH]O4C=;,#~0W*/B754r#c%경! ܻllOH$d"nVSXaPOdɇo{MּH@x_1_{'dJȻQwQU)! V(yw5to d"e?Tg5"WūfUCݨl0 @)}`eԧHtJzdc ( zphx뛳z??)yUϋrތ оqJԡ$ D#c;Dَ+?g36x;֑g&Z+f6}n0`(gpFKǎuw<F%8r Pшo1 ]S\^9:N"C!v`u85L67\A!; N?TmI]ge:omDBQzi=kh,J5nh Gß>eYkGű1B) 5CuQNDN/;-:Mgtn pN`uP뚪Kӭ$VoťL*2 3&D3sƘ |O?cdk.fS|/KBoy4M[(5lVZ(]?HʀK/T(^3cq ?Yy7xm堌ti`rľ!Q^j{UP-,H_F~+r{U ƒhvR-MQp h 2Q4KƱ~O @: ][O&0<ʝjg` Sv$:+!3iU 7!@bOMIʞ(bt@Bo;9T< pY ˶ GLᓏDr w+ F/X1E?}-ױ]$lJy2- b1 GP=߬ Ao)ٷ$}&ĆKRa(w_)MA'ԏшR͖ g,_t#wu rCRǎ:\˻\>^5cyD57-_Dc6 R+.ʳuHT$So7Zu$c2YAhrlZ?!vz<}fTޕٹ 6wXE$QY;N2oE ɖsw"\ OQ]:/P*%Z<e&z;ʺ*o(Z19%Zaƻh14 c~u=0gqᢝt(jZ#m5O*Zë^k6{t`ON18b-|VT,zze#G-ja ƣ\x}B@ e]n~!¢7 ;_j>A T" wtO0aa068acp pn˳"%d@Nzl ҏ?hq*IiUS7T( b: yN˳OaI3x9ga Ďl?-q8AĒ~)H;C|{7JkgV9dTm"anDŽeBmhd0*z@Ţ-3rJ<59LfL#J,y,8=J;B"Ķ#^ ~ׄc7AE'ժp|m-EF17PqCʜa|kS9|@itEn.mC f{]6bWI]OEHs RjbIptmYtMtV0hF H#swɅT-'uo5u G3qa|v6HEV0Hdra? wDZ~P?>gw9oĥ^kj *ⱂ_*xY!7锁m=NF8W W＇se~Me;Kݾ չShC~m졖<}qP>똦Ȏ~"V7-'u9)D˚oZ:<-?LNeF;MXP|#C5P\M&^ܴ$r!{-2#  М>J#x.HjCC`Og XNNSaձ~t\ڼx~A~q)DѪ@P"U/}&' \F|bΠ3UmuN 򢋄?ųqP'+R,?W̴t[m@*O BDAûa_N/qGEF;9N+6v(*#c- >vwq}׳)1S{.<>1KX6 ԑ >\i{`l~ ̮9&?fgv8nsfF:^,##DPB#o_u[ Us\Za9]R\OSٿm/J+.GnDEʃ%[vޢRkƄ3n"Џg?f mONuևLc10jW2rW5">a*=I3>Ur[i$ڐ3)Bo/[DOx= 1]D6`m/[xCKOkZwҡrkǣ{qOV7.o#Ũ&n׺Cd钲H׸M~hl"Z=!r,Qw*{[0$^Mv+f6'i~DV]-w-VSKa #( 9 slߊcJ`ƒ/qn4&oTW14C(%ZIJ6[yANxEۇT}(e LjCiaOjub@x F2DVw~4'hcvL[c mZKf%8F2_H7@/faBQƲd JnO=/4;3% _3fXR8WqV^s(jYÍGbۣUZEs\QvC2> ~cbk4 2E|AQ1n%xY@*' tn>o0UDj_U|II8f)! 0F S}![fueXq 믗 Ms)P8X85oRlbRx_cp:~>Zleh0>=w#) 6ÒR{!auM_]/Pˠ–T4z*aY0-[^MWA͛)uP&H}*Dk|Af-%!)(WX@CMl^= ьT* &7C'ĠJXC?SU.JAm>_t2&P:96KN GU 4/gYZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.note.gnu.property.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata 88$o``D( 0`` 8oH(H(EoH*H*8To**cP,P,mB   w@@r``}00$$ 0@  \l0v 0v hR## `C`#pCp#C# eDe$gDg$(pDp$ OHN( )  GN(l\S(8(S(x(7